KCC000289A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000289A_C01 KCC000289A_c01
cacacgcccagttactgctagatattagcgagggcgacaatggagccacggccagtgtct
ttgaccagcatttaacccttGCAATTGGTTGGCGAACAAAGCAAAATGGCTTCACCTGCG
CCGAGCGGCTCTCCGCCGCTCGTTATCTATAGCTGCACTGATGAGCAAATGCTAGAAGTG
ACCGAGCTAGTGGGCGACTCCGCGACAGCGGCCATAGTTTGTAGCCAATATGACTGCAGT
TTCACGGCAGTCAGCTGTGTGCTTAAGTATCTTGCCGCGCAACAAGCGGACTTGAGCGAG
CAAATGGACGGCACAGCCAAAGCGGAGGTCGCCTTGTCGCTAGACGTGGCGTTCCTCCTA
TTCAGCGCATACCTTGTGTTTGGACCGATGCAATTAGGCTTTGCGCTGCTCTGCGCGGGC
GCCATCCGCTCGAAAAATAGCATGAATGTGTTGATGAAGAACATCTTGGACGCGTGCACT
GGCGCCATCGGGTTCTACCTGTTCGGCTATGCGTTCGCGTTCGGACACCACGCCAACCAG
ACCTCCAACGCCTTCATCGGCGACCACAACTTCGCGCTGTCGTACACCACACAGGTCAGC
AGCCTCGACAGCAACGTCAGCTACGACGGGTTCGCCACGCAGGGCTGGCACGTGTTCTTC
TTCCAATGGAGCTTCTGCGCGGCCGCCACCACCATCGTGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000289A_C01 KCC000289A_c01
         (700 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM43911.1|AF509497_1 putative amt protein [Chlamydomonas rei...   399  e-110
gb|AAM43910.1|AF509496_1 putative amt protein [Chlamydomonas rei...   399  e-110
gb|AAL38652.1| putative ammonium transporter [Chlamydomonas rein...   177  1e-43
ref|NP_189072.1| ammonium transporter -related [Arabidopsis thal...   114  2e-24
gb|AAD54639.1|AF083036_1 ammonium transporter [Arabidopsis thali...   112  4e-24

>gb|AAM43911.1|AF509497_1 putative amt protein [Chlamydomonas reinhardtii]
          Length = 579

 Score =  399 bits (1026), Expect = e-110
 Identities = 198/198 (100%), Positives = 198/198 (100%)
 Frame = +1

Query: 106 MASPAPSGSPPLVIYSCTDEQMLEVTELVGDSATAAIVCSQYDCSFTAVSCVLKYLAAQQ 285
           MASPAPSGSPPLVIYSCTDEQMLEVTELVGDSATAAIVCSQYDCSFTAVSCVLKYLAAQQ
Sbjct: 1   MASPAPSGSPPLVIYSCTDEQMLEVTELVGDSATAAIVCSQYDCSFTAVSCVLKYLAAQQ 60

Query: 286 ADLSEQMDGTAKAEVALSLDVAFLLFSAYLVFGPMQLGFALLCAGAIRSKNSMNVLMKNI 465
           ADLSEQMDGTAKAEVALSLDVAFLLFSAYLVFGPMQLGFALLCAGAIRSKNSMNVLMKNI
Sbjct: 61  ADLSEQMDGTAKAEVALSLDVAFLLFSAYLVFGPMQLGFALLCAGAIRSKNSMNVLMKNI 120

Query: 466 LDACTGAIGFYLFGYAFAFGHHANQTSNAFIGDHNFALSYTTQVSSLDSNVSYDGFATQG 645
           LDACTGAIGFYLFGYAFAFGHHANQTSNAFIGDHNFALSYTTQVSSLDSNVSYDGFATQG
Sbjct: 121 LDACTGAIGFYLFGYAFAFGHHANQTSNAFIGDHNFALSYTTQVSSLDSNVSYDGFATQG 180

Query: 646 WHVFFFQWSFCAAATTIV 699
           WHVFFFQWSFCAAATTIV
Sbjct: 181 WHVFFFQWSFCAAATTIV 198

>gb|AAM43910.1|AF509496_1 putative amt protein [Chlamydomonas reinhardtii]
          Length = 579

 Score =  399 bits (1026), Expect = e-110
 Identities = 198/198 (100%), Positives = 198/198 (100%)
 Frame = +1

Query: 106 MASPAPSGSPPLVIYSCTDEQMLEVTELVGDSATAAIVCSQYDCSFTAVSCVLKYLAAQQ 285
           MASPAPSGSPPLVIYSCTDEQMLEVTELVGDSATAAIVCSQYDCSFTAVSCVLKYLAAQQ
Sbjct: 1   MASPAPSGSPPLVIYSCTDEQMLEVTELVGDSATAAIVCSQYDCSFTAVSCVLKYLAAQQ 60

Query: 286 ADLSEQMDGTAKAEVALSLDVAFLLFSAYLVFGPMQLGFALLCAGAIRSKNSMNVLMKNI 465
           ADLSEQMDGTAKAEVALSLDVAFLLFSAYLVFGPMQLGFALLCAGAIRSKNSMNVLMKNI
Sbjct: 61  ADLSEQMDGTAKAEVALSLDVAFLLFSAYLVFGPMQLGFALLCAGAIRSKNSMNVLMKNI 120

Query: 466 LDACTGAIGFYLFGYAFAFGHHANQTSNAFIGDHNFALSYTTQVSSLDSNVSYDGFATQG 645
           LDACTGAIGFYLFGYAFAFGHHANQTSNAFIGDHNFALSYTTQVSSLDSNVSYDGFATQG
Sbjct: 121 LDACTGAIGFYLFGYAFAFGHHANQTSNAFIGDHNFALSYTTQVSSLDSNVSYDGFATQG 180

Query: 646 WHVFFFQWSFCAAATTIV 699
           WHVFFFQWSFCAAATTIV
Sbjct: 181 WHVFFFQWSFCAAATTIV 198

>gb|AAL38652.1| putative ammonium transporter [Chlamydomonas reinhardtii]
           gi|19110913|gb|AAL85345.1|AF479643_1 ammonium
           transporter [Chlamydomonas reinhardtii]
          Length = 539

 Score =  177 bits (450), Expect = 1e-43
 Identities = 106/196 (54%), Positives = 126/196 (64%), Gaps = 5/196 (2%)
 Frame = +1

Query: 127 GSPPLVIYSCTDEQMLEVTELVG-----DSATAAIVCSQYDCSFTAVSCVLKYLAAQQAD 291
           GS PL   SC+ E    VT L+G     DS TA           +  +C+ +YL    AD
Sbjct: 6   GSEPLG--SCSVET---VTALLGYGLEQDSITALCQPEGGAGCTSTDNCMFQYLMGATAD 60

Query: 292 LSEQMDGTAKAEVALSLDVAFLLFSAYLVFGPMQLGFALLCAGAIRSKNSMNVLMKNILD 471
                  +  ++V + LDV+FLLFS YLVF  MQLGFA+LCAG+IRSKN MN+L+KN+LD
Sbjct: 61  AQ-----STASDVGVGLDVSFLLFSGYLVF-VMQLGFAVLCAGSIRSKNCMNILLKNMLD 114

Query: 472 ACTGAIGFYLFGYAFAFGHHANQTSNAFIGDHNFALSYTTQVSSLDSNVSYDGFATQGWH 651
           AC GAIGFY+FGYAFA+G    Q SN FIG+ NFALSYTTQ S     +S   F T GWH
Sbjct: 115 ACVGAIGFYVFGYAFAYGRKYGQNSNGFIGNWNFALSYTTQTS-----MSGTEFTTFGWH 169

Query: 652 VFFFQWSFCAAATTIV 699
            FFFQWSFCAA TTIV
Sbjct: 170 QFFFQWSFCAATTTIV 185

>ref|NP_189072.1| ammonium transporter -related [Arabidopsis thaliana]
           gi|11994690|dbj|BAB02928.1| ammonium transporter
           [Arabidopsis thaliana]
          Length = 496

 Score =  114 bits (284), Expect = 2e-24
 Identities = 67/167 (40%), Positives = 96/167 (57%), Gaps = 3/167 (1%)
 Frame = +1

Query: 205 TAAIVCSQYDCSFTA---VSCVLKYLAAQQADLSEQMDGTAKAEVALSLDVAFLLFSAYL 375
           + AI CS  D S       +    Y+  Q   ++ +       + A ++D  +LLFSAYL
Sbjct: 2   SGAITCSAADLSALLGPNATAAADYICGQLGSVNNKF-----TDAAYAIDNTYLLFSAYL 56

Query: 376 VFGPMQLGFALLCAGAIRSKNSMNVLMKNILDACTGAIGFYLFGYAFAFGHHANQTSNAF 555
           VF  MQLGFA+LCAG++R+KN+MN+++ N+LDA  G + +YLFGYAFAFG    ++S+ F
Sbjct: 57  VFA-MQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGGLFYYLFGYAFAFG----ESSDGF 111

Query: 556 IGDHNFALSYTTQVSSLDSNVSYDGFATQGWHVFFFQWSFCAAATTI 696
           IG HNF L       +L S+ S+          F +QW+F  AA  I
Sbjct: 112 IGRHNFGLQ---NFPTLTSDYSF----------FLYQWAFAIAAAGI 145

>gb|AAD54639.1|AF083036_1 ammonium transporter [Arabidopsis thaliana]
          Length = 514

 Score =  112 bits (281), Expect = 4e-24
 Identities = 72/174 (41%), Positives = 97/174 (55%), Gaps = 10/174 (5%)
 Frame = +1

Query: 205 TAAIVCSQYDCSF--------TAVSCVLKYLAAQQADLSEQMDGTAKAEVALSLDVAFLL 360
           TA   CS  D S         T+      +L +Q +++S ++  T  A     +D  +LL
Sbjct: 3   TATTTCSAVDLSALLSSSSNSTSSLAAATFLCSQISNISNKLSDTTYA-----VDNTYLL 57

Query: 361 FSAYLVFGPMQLGFALLCAGAIRSKNSMNVLMKNILDACTGAIGFYLFGYAFAFGHHANQ 540
           FSAYLVF  MQLGFA+LCAG++R+KN+MN+++ N+LDA  GAI +YLFG+AFAFG     
Sbjct: 58  FSAYLVFA-MQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGAISYYLFGFAFAFG----T 112

Query: 541 TSNAFIGDHN--FALSYTTQVSSLDSNVSYDGFATQGWHVFFFQWSFCAAATTI 696
            SN FIG H+  FALS            SY       +  F +QW+F  AA  I
Sbjct: 113 PSNGFIGRHHSFFALS------------SYPERPGSDFSFFLYQWAFAIAAAGI 154



EST assemble image


clone accession position
1 CL16g12_r AV394025 1 533
2 MXL061b12_r BP096585 317 700




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research