KCC000288A_c06
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000288A_C06 KCC000288A_c06
CTCGCAAGCATCGTCTGTCACTTCTCCGCAACCAGCTTCAACCTAATAGCAAAGATGGCC
CTCGCCTCTAAGGTTGCTACCCGCCCCGCCGTGGCCTCCCGCCCGGGGTGCCGTGTGGTT
GTGCTGCGCCTCCTGGCGAGTCGCTGCCGCGGACGGTGCTTGGGCTGTGTCTGCCTGGCT
GAGCTGCTGTCGCCTGCCTGTGGCCCCGCAAGGGCTGCCCCTTGGCTCTGACCCCCGTCG
ACCTGTTCGATGACCGCTCGGTTGCGCGACCGTGGCTTCGACCTGATCTACGAGGCCCGC
GACCTGGACCTGCCCCAGAACGTCCGTGAGGGCTTCACCCAGGCTCGCGCTTCCCTGGAC
GAGACCAAGAAGCGCGTGAAGGAGTCTGAGGCCCGCATCGACGCTGACCTGGACGTGTTC
ATCCAGAAGTCCTACTGGACTGAGGCTCGCGAGCAGCTGCGCCGCCAGGTCGGCACCCTG
CGCTTCGACCTGAACACCCTGGCCTCGACCAAGGAGAAGGAGGCCAAGAAGGCCGCCCTG
GGCCTGCGCAAGGAGTTCATCCAGGCCGTTGAGGACCTGGACTTCGCCCTGCGCGAGAAG
GACCAGGCCTCCGCCGCCAAGAAGCTGGAGATCACCAAGGCCAAGCTGGACTCCGTCCTG
GCCGCCGTCCTGTAAGCGCCCTCTTCTTTCCACCTAACAGCTGAATTTTCGGCCATCTCT
GGAGCTGCTGCAGCAGCAGCATGAGGATGGGGAGAATGTAAGCGGCTTTGGAGTGAGGAG
CAGCGGTTGCGTCGGTTGCAATGCAAGCGGTGGTGTGACGCGTCGGAACCTAGAACACGT
GTGACTGTCGTGTCAACTCGGGTCCGTGTGCGAAGGACGCGCTGTACGGGTGCAACCTCC
GGTGGCCTAAGAGTGGGCGCCTGGAGGAGTGGTACTGAGGGCAGTGCACGGGAGTGCGCG
GGTGTGCCGGTGCAGTTTTTGTTGTCTGCACTGGGCCGCCCTGCCGCTCCGCTTGGATGA
TGTGGCTTGTGTGTTTGGCCGCACGCTGCTTCCAGCGCGTTGCGCGCCTGTGTGCGGTTT
GATGGATTAGGCGGTTTTCCCCCAAGAGAAGACGATCAACGTAGAAAACAGGACAGGAGA
TAATCAATCTCCGCACATTTGGCAACCCCAGTTTGCCACGTGTATTCTCAAGCTTAGGCA
TGCAGCTCTTCTGGAGTGGCTCGCAACAGCACGGCGTGTAATACACACGCAGTGATACAT
AATTCTGCTCTGTACATGTTCCTTTGTCCTTGGTGTGTAACCACGGCAAGTC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000288A_C06 KCC000288A_c06
         (1312 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P12852|PSBQ_CHLRE Oxygen-evolving enhancer protein 3, chlorop...   283  5e-75
sp|Q41643|PSBQ_VOLCA Oxygen-evolving enhancer protein 3, chlorop...   214  4e-54
gb|AAP79208.1| oxygen-evolving enhancer protein 3 [Bigelowiella ...   114  3e-24
dbj|BAC83128.1| putative Oxygen-evolving enhancer protein 3-1, c...    70  8e-11
ref|NP_823727.1| putative translation initiation factor IF-2 [St...    67  5e-10

>sp|P12852|PSBQ_CHLRE Oxygen-evolving enhancer protein 3, chloroplast precursor (OEE3)
           gi|81254|pir||S05509 photosystem II oxygen-evolving
           complex protein 3 precursor - Chlamydomonas reinhardtii
           gi|18164|emb|CAA32061.1| OEE3 precursor protein
           [Chlamydomonas reinhardtii] gi|228626|prf||1807335B
           photosystem II OEE3 protein
          Length = 199

 Score =  283 bits (724), Expect = 5e-75
 Identities = 163/206 (79%), Positives = 164/206 (79%)
 Frame = +1

Query: 55  MALASKVATRPAVASRPGCRVVVLRLLASRCRGRCLGCVCLAELLSPACGPARAAPWL*P 234
           MALASKVATRPAVASR G  VV       R  G     V    L S     A  A     
Sbjct: 1   MALASKVATRPAVASRRGAVVV-------RASGESRRAVLGGLLASAVAAVAPKAALALT 53

Query: 235 PSTCSMTARLRDRGFDLIYEARDLDLPQNVREGFTQARASLDETKKRVKESEARIDADLD 414
           P        +RDRGFDLIYEARDLDLPQNVREGFTQARASLDETKKRVKESEARIDADLD
Sbjct: 54  PVDLFDDRSVRDRGFDLIYEARDLDLPQNVREGFTQARASLDETKKRVKESEARIDADLD 113

Query: 415 VFIQKSYWTEAREQLRRQVGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVEDLDFALR 594
           VFIQKSYWTEAREQLRRQVGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVEDLDFALR
Sbjct: 114 VFIQKSYWTEAREQLRRQVGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVEDLDFALR 173

Query: 595 EKDQASAAKKLEITKAKLDSVLAAVL 672
           EKDQASAAKKLEITKAKLDSVLAAVL
Sbjct: 174 EKDQASAAKKLEITKAKLDSVLAAVL 199

>sp|Q41643|PSBQ_VOLCA Oxygen-evolving enhancer protein 3, chloroplast precursor (OEE3)
           gi|7484418|pir||S72224 oxygen-evolving enhancer protein
           3 precursor - Volvox carteri gi|732536|gb|AAB40980.1|
           oxygen-evolving enhancer protein 3
          Length = 202

 Score =  214 bits (544), Expect = 4e-54
 Identities = 128/207 (61%), Positives = 146/207 (69%), Gaps = 1/207 (0%)
 Frame = +1

Query: 55  MALASKVATRPAVASRPGCRVVVLRLLASRCRGRCLGCVCLAELLSPACGPARAAPWL*P 234
           MALA KVA+RPAVASR G  VVV+R      R    G +    +   +   A+AA     
Sbjct: 1   MALAQKVASRPAVASRRG--VVVVRASVESRRAVLGGLLASTVVALTSANKAQAAA---T 55

Query: 235 PSTCSMTARLRDRGFDLIYEARDLDLPQNVREGFTQARASLDETKKRVKESEARIDADLD 414
           P       ++R+ GFDLIYEARDLDL Q+ R+G  QAR S+D T KRVKESE RIDADL+
Sbjct: 56  PVDLFDDRKVRETGFDLIYEARDLDLRQSARDGLDQARGSIDATIKRVKESETRIDADLE 115

Query: 415 VFIQKSYWTEAREQLRRQVGTLRFDLNTLASTK-EKEAKKAALGLRKEFIQAVEDLDFAL 591
            FI+K+YWTEAREQLRRQVGTLRFDLNTLAS K  K  KK AL L+KEFIQ VEDLDFAL
Sbjct: 116 GFIKKNYWTEAREQLRRQVGTLRFDLNTLASAKGVKAEKKKALELKKEFIQKVEDLDFAL 175

Query: 592 REKDQASAAKKLEITKAKLDSVLAAVL 672
           REKD+ SA KKLE  K+ LDSVLA VL
Sbjct: 176 REKDETSALKKLEAAKSALDSVLAYVL 202

>gb|AAP79208.1| oxygen-evolving enhancer protein 3 [Bigelowiella natans]
          Length = 237

 Score =  114 bits (286), Expect = 3e-24
 Identities = 60/135 (44%), Positives = 84/135 (61%)
 Frame = +1

Query: 259 RLRDRGFDLIYEARDLDLPQNVREGFTQARASLDETKKRVKESEARIDADLDVFIQKSYW 438
           + +  GF++IYEARDL L Q+ R+G TQAR  L ETKKR   +E ++  +   F+ K YW
Sbjct: 102 KAKKNGFEIIYEARDLSLDQDTRDGMTQARTGLQETKKRAIGAEKKL-TEAGSFVDKKYW 160

Query: 439 TEAREQLRRQVGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVEDLDFALREKDQASAA 618
           +E R  LRR VGTLRFDL  LA +K   AKK A+   K+F +A+E LD A+ +K+  +  
Sbjct: 161 SEGRTVLRRLVGTLRFDLAALADSKSGAAKKEAIKANKDFFEALESLDLAMYKKNVEAGQ 220

Query: 619 KKLEITKAKLDSVLA 663
           K  + T A   + L+
Sbjct: 221 KAYQKTMAAYKATLS 235

>dbj|BAC83128.1| putative Oxygen-evolving enhancer protein 3-1, chloroplast
           precursor (OEE3) [Oryza sativa (japonica
           cultivar-group)]
          Length = 213

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 60/185 (32%), Positives = 81/185 (43%), Gaps = 1/185 (0%)
 Frame = +1

Query: 112 RVVVLRLLASRCRGRCLGCVCLAELLSPA-CGPARAAPWL*PPSTCSMTARLRDRGFDLI 288
           R  VL L+A+   G  L    LAE   P   GP        PP +  +   L        
Sbjct: 42  RRAVLGLVATGIAGGALAQAALAEAAKPIKLGPP-------PPPSGGLPGTLNSD----- 89

Query: 289 YEARDLDLPQNVREGFTQARASLDETKKRVKESEARIDADLDVFIQKSYWTEAREQLRRQ 468
            +ARD DLP  +RE F        E   R KES   I  +L   I+K  W   R+ LR +
Sbjct: 90  -QARDTDLP--LRERFYLQPLPPAEAAARAKESAQDI-INLKPLIEKKQWPFVRDDLRLR 145

Query: 469 VGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVEDLDFALREKDQASAAKKLEITKAKL 648
              LR+DL T+ ++K K+ KK    L  +    ++ LD A + K    A K   +TK+ L
Sbjct: 146 ASYLRYDLKTVINSKPKDEKKGLKDLTGKLFATIDGLDHAAKIKSPEEAEKYYTLTKSAL 205

Query: 649 DSVLA 663
             VLA
Sbjct: 206 GDVLA 210

>ref|NP_823727.1| putative translation initiation factor IF-2 [Streptomyces
           avermitilis MA-4680] gi|29606199|dbj|BAC70262.1|
           putative translation initiation factor IF-2
           [Streptomyces avermitilis MA-4680]
          Length = 1046

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 69/213 (32%), Positives = 83/213 (38%), Gaps = 11/213 (5%)
 Frame = -1

Query: 685 KRALTGRRPGRSPAWPW*SPASWRRRPGPSRAGRSPGPQRPG*TPCAGPGRPSWPPSPWS 506
           +R     RP  +PA P   P     +P P  A  +P P  P  T  A P  P+ P +  S
Sbjct: 93  ERPAAAERPAAAPAAPGPRPGP---KPAPRPAPAAPAPAAPEFT--APPSAPAAPAAAAS 147

Query: 505 RPGCSGRSAGCRPGGAAAREPQSSRTSG*TRPGQRRCGPQTP--SRASWSRPGKREPG*S 332
            P    R    +PGGA    P   +  G  R  +   G +     R   +RPG + P   
Sbjct: 148 GPRPGARPGAPKPGGARPATPGQGQ-GGQVRGERTDRGDRGDRGDRQGAARPGGQAP--R 204

Query: 331 PHGR-SGAGPGRGPRRSGRSHGRATERSSNRSTGVRAKGQPLRGHRQATAAQPGRHSPST 155
           P  R +G  PG  P  SG S G A      R    R  G P    R   A  PG   P  
Sbjct: 205 PGARPAGPRPGNNPFTSGGSTGMA------RPQAPRPGGAP----RPGGAGAPGGPRPQG 254

Query: 154 VRGSD-------SPGGAAQPHGTPGG-RPRRGG 80
             G D        PGGA +P G PGG RP  GG
Sbjct: 255 AGGQDRAPRPQGGPGGAPRPQGGPGGARPTPGG 287

 Score = 60.1 bits (144), Expect = 9e-08
 Identities = 59/195 (30%), Positives = 74/195 (37%), Gaps = 20/195 (10%)
 Frame = -1

Query: 604 GPSRAGRSPGPQRPG*TPCAGPGRPSWPPSPWSRPGCSGRSAGC-RPGGAAAREPQSSRT 428
           G   A R   P +PG    A   RP+ P  P  +P  + R A   RP  A A        
Sbjct: 55  GGKAAPRKAAPAKPGAPSPAQAARPAAPRPPAPKPAAAERPAAAERPAAAPAAPGPRPGP 114

Query: 427 SG*TRPGQRRCGPQTP-------------SRASWSRPGKREPG*SPHGRSGAGPGRGPRR 287
               RP      P  P             + AS  RPG R     P G   A PG+G  +
Sbjct: 115 KPAPRPAPAAPAPAAPEFTAPPSAPAAPAAAASGPRPGARPGAPKPGGARPATPGQG--Q 172

Query: 286 SGRSHGRATERS-----SNRSTGVRAKGQPLRGHRQATAAQPGRHSPSTVRGSDSPGGAA 122
            G+  G  T+R       +R    R  GQ  R   +    +PG ++P T  GS    G A
Sbjct: 173 GGQVRGERTDRGDRGDRGDRQGAARPGGQAPRPGARPAGPRPG-NNPFTSGGST---GMA 228

Query: 121 QPHG-TPGGRPRRGG 80
           +P    PGG PR GG
Sbjct: 229 RPQAPRPGGAPRPGG 243

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 67/204 (32%), Positives = 75/204 (35%), Gaps = 7/204 (3%)
 Frame = -1

Query: 670 GRRPGRSPAWPW*SPASWR-RRPGPSRAGRSPGPQRPG*TPCAGPGRPSWPPSPWSRPGC 494
           G RPG +P     S    R + P P  A R  G   PG     G G     P P   PG 
Sbjct: 211 GPRPGNNPFTSGGSTGMARPQAPRPGGAPRPGGAGAPGGPRPQGAGGQDRAPRPQGGPGG 270

Query: 493 S----GRSAGCRPGGAAAREPQSSRTSG*TRPGQRRCGP-QTPSR-ASWSRPGKREPG*S 332
           +    G   G RP       PQ+ R  G   PG  R  P   P R A+  RPG   PG  
Sbjct: 271 APRPQGGPGGARPTPGGMPRPQAPRPGG--APGGNRPNPGMMPQRPAAGPRPGGGGPG-- 326

Query: 331 PHGRSGAGPGRGPRRSGRSHGRATERSSNRSTGVRAKGQPLRGHRQATAAQPGRHSPSTV 152
                G GPG G R  G   G        R  G    G+P  G     A +PG       
Sbjct: 327 -----GRGPGGGGRPGGPGGG------GGRPGGGGFAGRP-GGGGGGFAGRPGGPGGGGG 374

Query: 151 RGSDSPGGAAQPHGTPGGRPRRGG 80
             +  PGG   P G  GGRP  GG
Sbjct: 375 GFAGRPGG---PGGGGGGRPGFGG 395

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 72/238 (30%), Positives = 83/238 (34%), Gaps = 29/238 (12%)
 Frame = +3

Query: 39  QPNSKDGPRL*GCYP----PRRGLPPGVPCGCAAPPGESLPRTVLGLCLPG*AAVACLWP 206
           +P  K  PR     P    P    PP  P   AA      P    G   PG A  A    
Sbjct: 111 RPGPKPAPRPAPAAPAPAAPEFTAPPSAPAAPAAAASGPRPGARPGAPKPGGARPATPGQ 170

Query: 207 RKGCPLALTPVDLFD--DRSVARPWLRPDLRGPRPG--PAPERP*GLHP----GSRFPGR 362
            +G  +     D  D  DR   +   RP  + PRPG  PA  RP G +P    GS    R
Sbjct: 171 GQGGQVRGERTDRGDRGDRGDRQGAARPGGQAPRPGARPAGPRP-GNNPFTSGGSTGMAR 229

Query: 363 DQEAREGV*GPHRR*----PGRVHPEVL--LD*GSRAAAPPGRHP-------ALRPEHPG 503
            Q  R G  G  R      PG   P+     D   R    PG  P         RP   G
Sbjct: 230 PQAPRPG--GAPRPGGAGAPGGPRPQGAGGQDRAPRPQGGPGGAPRPQGGPGGARPTPGG 287

Query: 504 LDQGE----GGQEGRPGPAQGVHPGR*GPGLRPAREGPGLRRQEAGDHQGQAGLRPGR 665
           + + +    GG  G   P  G+ P R   G RP   GPG R    G   G  G   GR
Sbjct: 288 MPRPQAPRPGGAPGGNRPNPGMMPQRPAAGPRPGGGGPGGRGPGGGGRPGGPGGGGGR 345

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 58/188 (30%), Positives = 67/188 (34%), Gaps = 8/188 (4%)
 Frame = -1

Query: 712 PKIQLLGGKKRALTGRR-PGRSPAWPW*SPASWRRRPG------PSRAGRSPGPQRPG*T 554
           P+ Q  GG+ RA   +  PG +P  P   P   R  PG        R G +PG  RP   
Sbjct: 250 PRPQGAGGQDRAPRPQGGPGGAPR-PQGGPGGARPTPGGMPRPQAPRPGGAPGGNRPN-- 306

Query: 553 PCAGPGRPSWPPSPWSR-PGCSGRSAGCRPGGAAAREPQSSRTSG*TRPGQRRCGPQTPS 377
           P   P RP+  P P    PG  G   G RPGG            G  RPG          
Sbjct: 307 PGMMPQRPAAGPRPGGGGPGGRGPGGGGRPGGPGG---------GGGRPG---------G 348

Query: 376 RASWSRPGKREPG*SPHGRSGAGPGRGPRRSGRSHGRATERSSNRSTGVRAKGQPLRGHR 197
                RPG    G +  GR G   G G   +GR  G           G R  G   RG  
Sbjct: 349 GGFAGRPGGGGGGFA--GRPGGPGGGGGGFAGRPGGPGGGGGGRPGFGGRPGGPGGRGGT 406

Query: 196 QATAAQPG 173
           Q    +PG
Sbjct: 407 QGAFGRPG 414

 Score = 40.8 bits (94), Expect = 0.054
 Identities = 50/138 (36%), Positives = 51/138 (36%), Gaps = 6/138 (4%)
 Frame = +3

Query: 267 RPWLRPDLRGPRPGPAPERP*------GLHPGSRFPGRDQEAREGV*GPHRR*PGRVHPE 428
           RP   P    P PG  P+RP       G  PG R PG     R G  G     PG     
Sbjct: 295 RPGGAPGGNRPNPGMMPQRPAAGPRPGGGGPGGRGPGGG--GRPGGPGGGGGRPGG---- 348

Query: 429 VLLD*GSRAAAPPGRHPALRPEHPGLDQGEGGQEGRPGPAQGVHPGR*GPGLRPAREGPG 608
                G  A  P G          G   G GG  GRPG   G   GR G G RP   GPG
Sbjct: 349 -----GGFAGRPGGGGGGFAGRPGGPGGGGGGFAGRPGGPGGGGGGRPGFGGRPG--GPG 401

Query: 609 LRRQEAGDHQGQAGLRPG 662
            R    G  QG  G RPG
Sbjct: 402 GR----GGTQGAFG-RPG 414

 Score = 37.7 bits (86), Expect = 0.45
 Identities = 52/170 (30%), Positives = 56/170 (32%), Gaps = 19/170 (11%)
 Frame = +3

Query: 219 PLALTPVDLFDDRSVARPWLRPDLRGPRPGPAP-ERP*GLHPGSRFPGRDQEAREGV*GP 395
           P A  P       +  RP   P   GPRPGP P  RP    P    P             
Sbjct: 84  PPAPKPAAAERPAAAERPAAAPAAPGPRPGPKPAPRPAPAAPAPAAP------------E 131

Query: 396 HRR*PGRVHPEVLLD*GSRAAAPPG--RHPALRPEHPGLDQGEGGQ----------EGRP 539
               P           G R  A PG  +    RP  PG  QG+GGQ           G  
Sbjct: 132 FTAPPSAPAAPAAAASGPRPGARPGAPKPGGARPATPG--QGQGGQVRGERTDRGDRGDR 189

Query: 540 GPAQG-VHPGR*G--PGLRPAREGPGLRRQEAGDHQGQA---GLRPGRRP 671
           G  QG   PG     PG RPA   PG     +G   G A     RPG  P
Sbjct: 190 GDRQGAARPGGQAPRPGARPAGPRPGNNPFTSGGSTGMARPQAPRPGGAP 239



EST assemble image


clone accession position
1 MX214e07_r BP089829 1 218
2 MX224c02_r BP090460 7 264
3 MX254g11_r BP092485 13 492
4 MX251e03_r BP092241 14 476
5 HC021c02_r AV633473 15 344
6 MX255h09_r BP092558 18 523
7 MX248g05_r BP092031 33 545
8 LC056f08_r AV622928 45 547
9 CM065e01_r AV391128 65 631
10 HC054b08_r AV636025 78 669
11 LC002f04_r AV619015 131 716
12 CM093g07_r AV392990 175 695
13 CM041e09_r AV389400 213 485
14 CM087h03_r AV392454 214 717
15 MX231h09_r BP090973 229 755
16 LC003g01_r AV619096 243 792
17 HCL079a05_r AV643951 244 737
18 CM086e12_r AV392496 250 635
19 LC040d07_r AV621745 278 813
20 CM081d04_r AV391861 290 886
21 MX250g02_r BP092177 332 857
22 HC056g04_r AV636228 333 838
23 MX214c12_r BP089816 358 810
24 LC082c05_r AV624760 408 916
25 MXL074a01_r BP097330 414 552
26 MX011c01_r BP086548 576 1066
27 HC082e08_r AV638147 654 983
28 CL40e03_r AV395370 704 1191
29 HC013c04_r AV632840 708 1182
30 CM080b10_r AV392058 732 1321
31 CL16g06_r AV394036 747 1260
32 CM062d02_r AV390160 752 1349
33 CM017h07_r AV388146 774 1353
34 HC064g08_r AV636828 786 1325
35 CL76d04_r AV397118 793 1337
36 CL77a06_r AV397266 796 1273
37 CL69d03_r AV396813 823 1361
38 CL54g08_r AV396140 823 1295
39 CM044f08_r AV389558 834 1349
40 MX021a12_r BP086945 858 1281
41 CM002d07_r AV397838 865 1314
42 HCL028a04_r AV641115 895 1353
43 CM012b12_r AV387112 922 1287
44 HC083d01_r AV638212 989 1398




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research