KCC000287A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000287A_C01 KCC000287A_c01
CAGGTGTTCTTCCTGCTCAAGGAGAGCGAGCTGACGCCCACCGGCTCCAACCTGCTGGAC
GGCCGCTTCGCCGTGTTCGGCTACATCACGCAGGGCCAGGACGCGTTGGCGGACTTCAGG
GTGGGTGACAAGATTGAGTACATCAAGTTCGTGGACGGCAAGGAGAACCTGAAGAACAGC
CCGTAAATCCGCGGGGAGAGGTTGACGTTATGGGATGAGGCCGGTGGAGGGTTCTGTGTG
TAACTAGATTACGTTAGAAAGTAGGTGGCTGTATACGGACCTCGTTTGTGCCTGCCACTC
ACGATTTTGACGATGTGGAAGTAGCAAGGTACCGCGGGGTGAGTGAGTGCCGACTGACAC
GCGGCGTCACAGGAGATGGCATGTTGCTGGCCTGGGCACAACCCCATTTCCTCCATTCAA
TTTTTGACCTCGGATTTTTACACGAAAACTCCGGACGTTTGTATATGAAATCACCATCGT
TACTGAGGCAATCAGACCATACTGCTCGGCGAGTCCTACGCATCGCCATTTTGTAATTAC
AACTCGGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000287A_C01 KCC000287A_c01
         (548 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_186797.1| thylakoid lumen rotamase [Arabidopsis thaliana]...    84  1e-15
sp|O49939|TL40_SPIOL Peptidyl-prolyl cis-trans isomerase, chloro...    81  8e-15
pir||T06363 hypothetical protein precursor - garden pea gi|26232...    79  5e-14
gb|AAP79162.1| thylakoid lumen protease [Bigelowiella natans]          77  1e-13
ref|NP_681610.1| peptidyl-prolyl cis-trans isomerase [Thermosyne...    74  1e-12

>ref|NP_186797.1| thylakoid lumen rotamase [Arabidopsis thaliana]
           gi|6016707|gb|AAF01533.1|AC009325_3 putative thylakoid
           lumen rotamase [Arabidopsis thaliana]
           gi|14532438|gb|AAK63947.1| AT3g01480/F4P13_3
           [Arabidopsis thaliana] gi|21360549|gb|AAM47471.1|
           AT3g01480/F4P13_3 [Arabidopsis thaliana]
           gi|21593368|gb|AAM65317.1| putative thylakoid lumen
           rotamase [Arabidopsis thaliana]
          Length = 437

 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 40/59 (67%), Positives = 48/59 (80%)
 Frame = +1

Query: 1   QVFFLLKESELTPTGSNLLDGRFAVFGYITQGQDALADFRVGDKIEYIKFVDGKENLKN 177
           QVF+LLKESELTP+ SN+LDGR+AVFGY+T  +D LAD +VGD IE I+ V G ENL N
Sbjct: 372 QVFWLLKESELTPSNSNILDGRYAVFGYVTDNEDFLADLKVGDVIESIQVVSGLENLAN 430

>sp|O49939|TL40_SPIOL Peptidyl-prolyl cis-trans isomerase, chloroplast precursor (40 kDa
           thylakoid lumen PPIase) (40 kDa thylakoid lumen
           rotamase) gi|7484684|pir||T09212 rotamase tlr40
           precursor, thylakoid lumen - spinach
           gi|2864602|emb|CAA72792.1| thylakoid lumen rotamase
           [Spinacia oleracea]
          Length = 449

 Score = 81.3 bits (199), Expect = 8e-15
 Identities = 37/59 (62%), Positives = 48/59 (80%)
 Frame = +1

Query: 1   QVFFLLKESELTPTGSNLLDGRFAVFGYITQGQDALADFRVGDKIEYIKFVDGKENLKN 177
           Q+F+LLKESELTP+ +N+LDGR+AVFGY+T  QD LAD +VGD IE ++ V G +NL N
Sbjct: 384 QIFWLLKESELTPSNANILDGRYAVFGYVTDNQDYLADLKVGDVIESVQAVSGVDNLVN 442

>pir||T06363 hypothetical protein precursor - garden pea
           gi|2623246|gb|AAC50041.1| poly(A) polymerase [Pisum
           sativum]
          Length = 454

 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 37/59 (62%), Positives = 47/59 (78%)
 Frame = +1

Query: 1   QVFFLLKESELTPTGSNLLDGRFAVFGYITQGQDALADFRVGDKIEYIKFVDGKENLKN 177
           QVF+LLKESELTP+ +N+L GR+AVFGY+T+ +D LAD +VGD IE I+ V G  NL N
Sbjct: 389 QVFWLLKESELTPSNANILHGRYAVFGYVTENEDFLADLKVGDVIESIQVVSGLHNLVN 447

>gb|AAP79162.1| thylakoid lumen protease [Bigelowiella natans]
          Length = 226

 Score = 77.4 bits (189), Expect = 1e-13
 Identities = 33/58 (56%), Positives = 47/58 (80%)
 Frame = +1

Query: 1   QVFFLLKESELTPTGSNLLDGRFAVFGYITQGQDALADFRVGDKIEYIKFVDGKENLK 174
           Q+F+LLK++++TP+G+N+LDGRFAVFGY T+  DAL + RVGDKIE ++   G E+ K
Sbjct: 165 QIFWLLKDNDMTPSGTNVLDGRFAVFGYTTKNNDALRELRVGDKIESVRITSGLEHFK 222

>ref|NP_681610.1| peptidyl-prolyl cis-trans isomerase [Thermosynechococcus elongatus
           BP-1] gi|22294542|dbj|BAC08372.1| peptidyl-prolyl
           cis-trans isomerase [Thermosynechococcus elongatus BP-1]
          Length = 392

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 36/57 (63%), Positives = 41/57 (71%)
 Frame = +1

Query: 1   QVFFLLKESELTPTGSNLLDGRFAVFGYITQGQDALADFRVGDKIEYIKFVDGKENL 171
           Q FFLL E ELTP G NLLDGR+AVFGY+ +G++ L   R GDKI   K VDG ENL
Sbjct: 332 QFFFLLFEPELTPAGLNLLDGRYAVFGYVVEGEETLRQLRQGDKILSAKVVDGLENL 388



EST assemble image


clone accession position
1 CL16f06_r AV394035 1 618
2 LC086e01_r AV625032 113 634




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research