KCC000285A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000285A_C02 KCC000285A_c02
GCTACAACTTCGGCACAAGAGAATGCGAGAATAACACATAATCTGCAACTAGTTGTCCGA
CAATAGAGTCTGTGTCCTGGCAAGCTGCAAAATGTCAGCGGCCCGTTCAGCAAGGCTGAT
GGCGCGTATTGTGCGGCTGCTGGTTGAGCTCAAGGGCGGAGCCCGAGTGGCGGGGCGCAA
CATCGCGCAGCAGACTAATGGCGCGGCTGGTGGTGCGGTGGGCCGGGGGCTGACCAAGGG
CGCCACAGCCAACACGGGCATGATGAAGGACCTGGCCAACGGCGGCCGTAACTTCTGGAG
CCACATGCCCAAGTCGCCGCAGCTGCCGGGCGCACTCAGCGACGCCGCGCACCTGAATGA
GGACTTCCATGGGGGAGACCACGATGACAGCGAGGGCGATGGCAGCTTGTTCGGCGGACA
TCTGTTAGAGGAGCTCGCGGCAATGGAAAGCCACCTGCTGGACTGGGCTTCGCTGCGCAC
AGACACGCCGGCGGACGTGCTGCTGTCCATCCTGTCCGACATGCTGGACGGCCGGGAGCC
CGACCTGCGCGAGGTGGCGCTGGCGCGCAGTGTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000285A_C02 KCC000285A_c02
         (574 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAB46679.1| proteophosphoglycan [Leishmania major]                 46  3e-04
dbj|BAA13216.1| KIAA0227 [Homo sapiens]                                45  5e-04
ref|XP_027236.2| similar to KIAA0227 [Homo sapiens]                    45  5e-04
ref|NP_042661.1| tegument protein [Equine herpesvirus 2] gi|1360...    45  7e-04
gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]                       45  7e-04

>emb|CAB46679.1| proteophosphoglycan [Leishmania major]
          Length = 873

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 49/157 (31%), Positives = 68/157 (43%), Gaps = 1/157 (0%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPSLS 385
            +SA S  S S PSS      SS+SA  +  S A SS   S  ++SS+  P +   +PS S
Sbjct: 651  SSAPSASSSSAPSS------SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSAS 704

Query: 384  SWSPPWKSSFR-CAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTAPP 208
            S S P  SS    A+S SAP S             P + S   P  + +   S   +AP 
Sbjct: 705  SSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPS 764

Query: 207  AAPLVCCAMLRPATRAPPLSSTSSRTIRAISLAERAA 97
            A+     +    A  A   S+ SS +  A S +  +A
Sbjct: 765  ASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSA 801

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 3/146 (2%)
 Frame = -2

Query: 564  ASATSRRSGSRPS-SMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPSL 388
            +SA S  S S PS S S    SS+S+  S  S +  S   S  ++SS+  P +   +PS 
Sbjct: 721  SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA 780

Query: 387  SSWSPPWKSSFRC--AASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTA 214
            SS S P  SS     A+S SAP S             P + S   P  + +   S   ++
Sbjct: 781  SSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSS 840

Query: 213  PPAAPLVCCAMLRPATRAPPLSSTSS 136
             P+A     +    ++ AP  SS+S+
Sbjct: 841  APSAS--SSSASSSSSSAPSASSSSA 864

 Score = 41.6 bits (96), Expect = 0.008
 Identities = 42/145 (28%), Positives = 64/145 (43%), Gaps = 2/145 (1%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPS--PS 391
            +S+ S  S S PS+ S    SS+S+  S  S +  S   S A S+S+   P+   S  PS
Sbjct: 628  SSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPS 687

Query: 390  LSSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTAP 211
             SS S P  SS   +AS S+  S             P + S   P  + +   S   ++ 
Sbjct: 688  ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSA 747

Query: 210  PAAPLVCCAMLRPATRAPPLSSTSS 136
            P+A     +    ++ AP  SS+S+
Sbjct: 748  PSAS--SSSAPSSSSSAPSASSSSA 770

 Score = 41.6 bits (96), Expect = 0.008
 Identities = 46/152 (30%), Positives = 66/152 (43%), Gaps = 9/152 (5%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPP---NKLPS- 397
            +SA S  S S PSS S    +S+S+  S  S A S+   S  +SSS+  P    +  PS 
Sbjct: 683  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS 742

Query: 396  -----PSLSSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLV 232
                 PS SS S P  SS   +AS S+  S             P + S   P  + +   
Sbjct: 743  SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAP 802

Query: 231  SPRPTAPPAAPLVCCAMLRPATRAPPLSSTSS 136
            S   ++ P+A     A    ++ AP  SS+S+
Sbjct: 803  SSSSSSAPSAS-SSSAPSSSSSSAPSASSSSA 833

 Score = 39.7 bits (91), Expect = 0.030
 Identities = 43/149 (28%), Positives = 63/149 (41%), Gaps = 6/149 (4%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPS-PSL 388
            +SA S  S S  SS S    +S+S+  S  S A S+   S  +SSS+  P     S PS 
Sbjct: 621  SSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS 680

Query: 387  SSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTAPP 208
            SS S P  SS    +S S+  S             P A S   P  + +   S   ++ P
Sbjct: 681  SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAP 740

Query: 207  -----AAPLVCCAMLRPATRAPPLSSTSS 136
                 +AP    +    ++ + P +S+SS
Sbjct: 741  SSSSSSAPSASSSSAPSSSSSAPSASSSS 769

 Score = 38.1 bits (87), Expect = 0.086
 Identities = 44/139 (31%), Positives = 61/139 (43%), Gaps = 3/139 (2%)
 Frame = -2

Query: 543  SGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPS-PSLSSWSPPW 367
            S S PS+ S    SS+S+  S  S +  S   S  ++SS+  P +   S PS SS S P 
Sbjct: 620  SSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS 679

Query: 366  KSSFRC--AASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTAPPAAPLV 193
             SS     A+S SAP S            P  + S      + AP  S   +AP A+   
Sbjct: 680  SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP-SSSSSSAPSASS-- 736

Query: 192  CCAMLRPATRAPPLSSTSS 136
              A    ++ AP  SS+S+
Sbjct: 737  SSAPSSSSSSAPSASSSSA 755

 Score = 35.8 bits (81), Expect = 0.43
 Identities = 34/82 (41%), Positives = 41/82 (49%), Gaps = 3/82 (3%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDS--STSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPS 391
            +SA S  S S PSS S    S  S+SA  S  S A S+   S  +SSS+  P     S S
Sbjct: 791  SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAS 850

Query: 390  LSSWS-PPWKSSFRCAASLSAP 328
             SS S P   SS   ++S SAP
Sbjct: 851  SSSSSAPSASSSSAPSSSSSAP 872

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 33/85 (38%), Positives = 43/85 (49%), Gaps = 4/85 (4%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGV--SVRSEAQSSRWLSIAASSSNRCPPNKLPS-P 394
            +SA S  S S PS+ S    SS+S+    +  S A SS   S  ++SS+  P +   S P
Sbjct: 783  SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP 842

Query: 393  SLSSWSPPWKSSFR-CAASLSAPGS 322
            S SS S    SS    A+S SAP S
Sbjct: 843  SASSSSASSSSSSAPSASSSSAPSS 867

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 36/127 (28%), Positives = 52/127 (40%)
 Frame = -2

Query: 477 RSEAQSSRWLSIAASSSNRCPPNKLPSPSLSSWSPPWKSSFRCAASLSAPGSCGDLGMWL 298
           + E +SS     A+SSS     +  PS S SS +P   SS   A+S SAP S        
Sbjct: 614 KPETESSSSAPSASSSSASSSSSSAPSASSSS-APSSSSSAPSASSSSAPSSSSSSAPSA 672

Query: 297 QKLRPPLARSFIMPVLAVAPLVSPRPTAPPAAPLVCCAMLRPATRAPPLSSTSSRTIRAI 118
                P + S   P  + +   S   +AP A+     +    A  A   S+ SS +  A 
Sbjct: 673 SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAP 732

Query: 117 SLAERAA 97
           S +  +A
Sbjct: 733 SASSSSA 739

>dbj|BAA13216.1| KIAA0227 [Homo sapiens]
          Length = 336

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 48/156 (30%), Positives = 60/156 (37%)
 Frame = +1

Query: 100 GPFSKADGAYCAAAG*AQGRSPSGGAQHRAAD*WRGWWCGGPGADQGRHSQHGHDEGPGQ 279
           GP S+A  A   AA  + G + S G Q  A                G H +H   E  G 
Sbjct: 41  GPASEAAAAAAGAASGSSGENGSAGRQTAA----------------GCHGRHEACEARG- 83

Query: 280 RRP*LLEPHAQVAAAAGRTQRRRAPE*GLPWGRPR*QRGRWQLVRRTSVRGARGNGKPPA 459
           RRP LL P  +     G          G    R R +RG  ++ R+ S  GA+GN  PPA
Sbjct: 84  RRPRLLNPGRRGGGGGG----------GQIAARTR-RRGGGRMERKGSAAGAKGNPSPPA 132

Query: 460 GLGFAAHRHAGGRAAVHPVRHAGRPGARPARGGAGA 567
                      G+    P+   G  G  PARG  GA
Sbjct: 133 A--------GEGQRPPPPLCVPGGGGGAPARGQVGA 160

>ref|XP_027236.2| similar to KIAA0227 [Homo sapiens]
          Length = 379

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 48/156 (30%), Positives = 60/156 (37%)
 Frame = +1

Query: 100 GPFSKADGAYCAAAG*AQGRSPSGGAQHRAAD*WRGWWCGGPGADQGRHSQHGHDEGPGQ 279
           GP S+A  A   AA  + G + S G Q  A                G H +H   E  G 
Sbjct: 84  GPASEAAAAAAGAASGSSGENGSAGRQTAA----------------GCHGRHEACEARG- 126

Query: 280 RRP*LLEPHAQVAAAAGRTQRRRAPE*GLPWGRPR*QRGRWQLVRRTSVRGARGNGKPPA 459
           RRP LL P  +     G          G    R R +RG  ++ R+ S  GA+GN  PPA
Sbjct: 127 RRPRLLNPGRRGGGGGG----------GQIAARTR-RRGGGRMERKGSAAGAKGNPSPPA 175

Query: 460 GLGFAAHRHAGGRAAVHPVRHAGRPGARPARGGAGA 567
                      G+    P+   G  G  PARG  GA
Sbjct: 176 A--------GEGQRPPPPLCVPGGGGGAPARGQVGA 203

>ref|NP_042661.1| tegument protein [Equine herpesvirus 2] gi|1360829|pir||S55659
            tegument protein 64 - equine herpesvirus 2
            gi|695237|gb|AAC13852.1| tegument protein
          Length = 3436

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 49/142 (34%), Positives = 55/142 (38%), Gaps = 2/142 (1%)
 Frame = +1

Query: 151  QGRSPSGGAQHRAAD*WRGWWCGGPGADQGRHSQHGHDEGPGQRRP*LLEPHAQVAAAAG 330
            +G  P+GG    +     G   G  G   G HS      GP   RP  L P  Q    AG
Sbjct: 2670 RGWGPAGGPVRDSGQEAGGGAAGHAGQPVGGHS------GPRAGRPGRL-PRQQDRVRAG 2722

Query: 331  RTQRRRAPE*GLPWGRPR*QRGRWQLVRRTSVRGARGNGKPPAGLGFAAHRHAGGRAAVH 510
            +   R  P       RPR QRGR    R       RG  + P  +G AA        A H
Sbjct: 2723 QPLLRHDPL------RPRGQRGRPGAGRGAEKPRGRGPARDPPPVGAAA--------AGH 2768

Query: 511  PVRHAGRPGAR--PARGGAGAQ 570
            P R  GR  AR  P  GG GAQ
Sbjct: 2769 PARAGGRLPARPLPEGGGGGAQ 2790

>gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]
          Length = 1325

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 42/147 (28%), Positives = 66/147 (44%), Gaps = 4/147 (2%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPSLS 385
            +SA S  S S PSS S    +S+S+  S  S A S+   S  +SSS+    +   +PS S
Sbjct: 683  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 742

Query: 384  SWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTAP-- 211
            S +P   SS   ++S SAP +             P A S   P  + +   +   +AP  
Sbjct: 743  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 802

Query: 210  --PAAPLVCCAMLRPATRAPPLSSTSS 136
               +AP    +    ++ + P +S+SS
Sbjct: 803  SSSSAPSASSSSAPSSSSSAPSASSSS 829

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 42/143 (29%), Positives = 65/143 (45%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPSLS 385
            +SA S  S S PSS S    +S+S+  S  S A S+   S  +SSS+    +   +PS S
Sbjct: 805  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 864

Query: 384  SWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTAPPA 205
            S +P   SS   ++S SAP +             P A S   P  + +   S   ++ P+
Sbjct: 865  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS 924

Query: 204  APLVCCAMLRPATRAPPLSSTSS 136
            +     A    ++ AP  SS+S+
Sbjct: 925  SS-SSSAPSASSSSAPSSSSSSA 946

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 48/157 (30%), Positives = 66/157 (41%), Gaps = 1/157 (0%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPS-PSL 388
            +SA S  S S PSS S    +S+S+  S  S A S+   S  +SSS+  P     S PS 
Sbjct: 850  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS 909

Query: 387  SSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTAPP 208
            SS S P       A+S SAP S             P + S   P  + +   S   +AP 
Sbjct: 910  SSSSAP------SASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPS 963

Query: 207  AAPLVCCAMLRPATRAPPLSSTSSRTIRAISLAERAA 97
            A+     +    A  A   S+ SS +  A S +  +A
Sbjct: 964  ASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSA 1000

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 44/147 (29%), Positives = 66/147 (43%), Gaps = 4/147 (2%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPSLS 385
            +SA S  S S PSS S    +S+S+  S  S A S+   S  +SSS+    +   +PS S
Sbjct: 713  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 772

Query: 384  SWSPPWKSSFRC-AASLSAPGSCGDLGMWLQKLRPPLARSFIMP---VLAVAPLVSPRPT 217
            S S P  SS    ++S SAP +             P A S   P     A +   S  P+
Sbjct: 773  SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPS 832

Query: 216  APPAAPLVCCAMLRPATRAPPLSSTSS 136
            +  +AP    +    ++ + P +S+SS
Sbjct: 833  SSSSAPSASSSSAPSSSSSAPSASSSS 859

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 41/145 (28%), Positives = 64/145 (43%), Gaps = 2/145 (1%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPSLS 385
            +S+    S S PS+ S    SS+S+  S  S +  S   S  ++SS+  P +   +PS S
Sbjct: 827  SSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSAS 886

Query: 384  SWSPPWKSSFRC--AASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTAP 211
            S S P  SS     A+S SAP S             P + S   P  + +   S   ++ 
Sbjct: 887  SSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSA 946

Query: 210  PAAPLVCCAMLRPATRAPPLSSTSS 136
            P+A     +    ++ AP  SS+S+
Sbjct: 947  PSAS--SSSAPSSSSSAPSASSSSA 969

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 45/162 (27%), Positives = 71/162 (43%), Gaps = 5/162 (3%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCP-PNKLPSPSL 388
            +SA S  S S PSS S    +S+S+  S  S A S+   S  +SSS+  P  +   +PS 
Sbjct: 944  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS 1003

Query: 387  SSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVS----PRP 220
            SS +P   SS   ++S SAP +            P  + S      + AP  S    P  
Sbjct: 1004 SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 1063

Query: 219  TAPPAAPLVCCAMLRPATRAPPLSSTSSRTIRAISLAERAAD 94
            ++  A      +    ++ AP  SS+S+ +  +  L+   +D
Sbjct: 1064 SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSFLSGSGSD 1105

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 44/147 (29%), Positives = 65/147 (43%), Gaps = 4/147 (2%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPS-PSL 388
            +SA S  S S PSS S    +S+S+  S  S A S+   S  +SSS+  P     S PS 
Sbjct: 728  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS 787

Query: 387  SSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMP---VLAVAPLVSPRPT 217
            SS +P   SS   ++S S+  S             P A S   P     A +   S  P+
Sbjct: 788  SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS 847

Query: 216  APPAAPLVCCAMLRPATRAPPLSSTSS 136
            +  +AP    +    ++ + P +S+SS
Sbjct: 848  SSSSAPSASSSSAPSSSSSAPSASSSS 874

 Score = 42.4 bits (98), Expect = 0.005
 Identities = 45/150 (30%), Positives = 64/150 (42%), Gaps = 1/150 (0%)
 Frame = -2

Query: 543  SGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPSLSSWSPPWK 364
            S S PS+ S    SS+S+  S  S +  S   S  ++SS+  P +   +PS SS S P  
Sbjct: 667  SSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 726

Query: 363  SSFR-CAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTAPPAAPLVCC 187
            SS    A+S SAP S            P  + S      + AP  S   +AP A+     
Sbjct: 727  SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP-SSSSSSAPSASSSSAP 785

Query: 186  AMLRPATRAPPLSSTSSRTIRAISLAERAA 97
            +    A  A   S+ SS +  A S +  +A
Sbjct: 786  SSSSSAPSASSSSAPSSSSSSAPSASSSSA 815

 Score = 42.4 bits (98), Expect = 0.005
 Identities = 50/166 (30%), Positives = 71/166 (42%), Gaps = 10/166 (6%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPP---NKLPS- 397
            +SA S  S S PSS S    +S+S+  S  S +  S   S A SSS+  P    +  PS 
Sbjct: 743  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 802

Query: 396  -----PSLSSWSPPWKSSFR-CAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPL 235
                 PS SS S P  SS    A+S SAP S            P  + S      A +  
Sbjct: 803  SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS------APSAS 856

Query: 234  VSPRPTAPPAAPLVCCAMLRPATRAPPLSSTSSRTIRAISLAERAA 97
             S  P++  +AP    +    ++ + P +S+SS    + S A  A+
Sbjct: 857  SSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSAS 902

 Score = 41.6 bits (96), Expect = 0.008
 Identities = 50/185 (27%), Positives = 76/185 (41%), Gaps = 4/185 (2%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPS-PSL 388
            +SA S  S S PSS S    S++S+     S +  S   S A SSS+  P     S PS 
Sbjct: 928  SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 987

Query: 387  SSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMP---VLAVAPLVSPRPT 217
            SS S P  SS    +S S+  S             P A S   P     A +   S  P+
Sbjct: 988  SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS 1047

Query: 216  APPAAPLVCCAMLRPATRAPPLSSTSSRTIRAISLAERAADILQLARTQTLLSDN*LQIM 37
            +  +AP    +    ++ +   S++SS    + S A  A+     + + + LS +     
Sbjct: 1048 SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSFLSGSGSDGG 1107

Query: 36   CYSRI 22
            C+S +
Sbjct: 1108 CHSDV 1112

 Score = 41.6 bits (96), Expect = 0.008
 Identities = 45/161 (27%), Positives = 69/161 (41%), Gaps = 5/161 (3%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCP-PNKLPSPSL 388
            +SA S  S S PSS S    +S+S+  S  S +  S   S A SSS+  P  +   +PS 
Sbjct: 774  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 833

Query: 387  SSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVS----PRP 220
            SS +P   SS   ++S SAP +            P  + S      + AP  S    P  
Sbjct: 834  SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 893

Query: 219  TAPPAAPLVCCAMLRPATRAPPLSSTSSRTIRAISLAERAA 97
            ++  A      +    ++ + P +S+SS    + S A  A+
Sbjct: 894  SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSAS 934

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 47/161 (29%), Positives = 70/161 (43%), Gaps = 5/161 (3%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDS--STSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPS 391
            +SA S  S S PSS S    S  S+SA  S  S A S+   S  +SSS+    +   +PS
Sbjct: 912  SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPS 971

Query: 390  LSSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMP---VLAVAPLVSPRP 220
             SS +P   SS   ++S S+  S             P A S   P     A +   S  P
Sbjct: 972  SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP 1031

Query: 219  TAPPAAPLVCCAMLRPATRAPPLSSTSSRTIRAISLAERAA 97
            ++  +AP    +    ++ + P +S+SS    + S A  A+
Sbjct: 1032 SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSAS 1072

 Score = 40.8 bits (94), Expect = 0.013
 Identities = 43/146 (29%), Positives = 65/146 (44%), Gaps = 3/146 (2%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGV--SVRSEAQSSRWLSIAASSSNRCPPNKLPS-P 394
            +SA S  S S PS+ S    SS+S+    +  S A SS   S  ++SS+  P +   S P
Sbjct: 888  SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAP 947

Query: 393  SLSSWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPRPTA 214
            S SS S P  SS   +AS S+  S             P + S   P    +   S  P++
Sbjct: 948  SASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAP----SASSSSAPSS 1003

Query: 213  PPAAPLVCCAMLRPATRAPPLSSTSS 136
              +AP    +    ++ + P +S+SS
Sbjct: 1004 SSSAPSASSSSAPSSSSSAPSASSSS 1029

 Score = 40.0 bits (92), Expect = 0.023
 Identities = 43/150 (28%), Positives = 65/150 (42%), Gaps = 7/150 (4%)
 Frame = -2

Query: 564  ASATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPSLS 385
            +SA S  S S  SS S    +S+S+  S  S A S+   S  +SSS+    +   +PS S
Sbjct: 668  SSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 727

Query: 384  SWSPPWKSSFRCAASLSAPGSCGDLGMWLQKLRP-------PLARSFIMPVLAVAPLVSP 226
            S +P   SS   ++S SAP +            P       P + S   P  + +   S 
Sbjct: 728  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS 787

Query: 225  RPTAPPAAPLVCCAMLRPATRAPPLSSTSS 136
              +AP A+     A    ++ AP  SS+S+
Sbjct: 788  SSSAPSASS--SSAPSSSSSSAPSASSSSA 815

 Score = 35.4 bits (80), Expect = 0.56
 Identities = 39/157 (24%), Positives = 64/157 (39%), Gaps = 3/157 (1%)
 Frame = -2

Query: 558  ATSRRSGSRPSSMSDRMDSSTSAGVSVRSEAQSSRWLSIAASSSNRCPPNKLPSPSLSSW 379
            AT         S S    +S+S+  S  S A S+   S  +SSS+    +   +PS SS 
Sbjct: 655  ATENACKPETESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 714

Query: 378  SPPWKSSFRCAASLSAPGSCGDLGMWLQKLRPPLARSFIMPVLAVAPLVSPR---PTAPP 208
            +P   SS   ++S SAP +            P  + S      + AP  S      ++  
Sbjct: 715  APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 774

Query: 207  AAPLVCCAMLRPATRAPPLSSTSSRTIRAISLAERAA 97
            +AP    +    ++ + P +S+SS    + S A  A+
Sbjct: 775  SAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSAS 811



EST assemble image


clone accession position
1 LCL091h03_r AV631312 1 274
2 CL62f01_r AV396431 3 525
3 LCL082f07_r AV630684 4 400
4 CL16e07_r AV394019 5 523
5 LCL003g01_r AV626180 16 479
6 CL59h08_r AV397935 19 583
7 MXL047b03_r BP095769 26 193




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research