KCC000284A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000284A_C01 KCC000284A_c01
cacaatcattgtGAGCTGTCAAAGTAGAGAGGCGCCCTGCTCAAATGCTCCCTATACTCG
ACCGTTGAAAGAACACAACCAGGATGGCTGCACAGCACAAAGACTCGAAGGCGAAGGCGC
TTGCAACAGCTTCAACTCTACAAAGAGTTGTGTGTCCGAGCACAGAGCGGGACCCCCTTG
CTTTTTTGAGCTCCGGGTACCGAAAAGTCGATGAGCAGAAGCGATACACGAACCGCTTGA
CGAACCTTCCTGATAAGGGCGTGGGCGTGGTATCCCGTGAAGGCTCCTTCTCCGAACCAC
TCCCTGGGCCCAGCAAAGGCCCACCCCGAACTAATGGGCGGGCGGTGCTGGACCAGATGT
TCGGCCACCTCAGGCCCCACCACAACATTGCAGAGCCGGCACTGCTTCAAATGGAGCAGC
ATGAGTTGGAGAATGGACTGGGCGATCAAGCCGCCCGCGCCGCGTTCTACCGACCCTCTA
TCACGGCAGCACTCATG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000284A_C01 KCC000284A_c01
         (497 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_230853.2| similar to junctophilin type 2 [Rattus norvegicus]    37  0.10
ref|NP_067541.1| junctophilin 2 [Mus musculus] gi|27805488|sp|Q9...    37  0.10
ref|NP_079192.1| hypothetical protein FLJ22814 [Homo sapiens] gi...    35  0.39
pir||JC6316 probable protein kinase (EC 2.7.1.-) - fruit fly (Dr...    35  0.39
ref|NP_032926.1| POU domain, class 3, transcription factor 3 [Mu...    35  0.51

>ref|XP_230853.2| similar to junctophilin type 2 [Rattus norvegicus]
          Length = 692

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 29/80 (36%), Positives = 36/80 (44%), Gaps = 4/80 (5%)
 Frame = +2

Query: 230 EPLDEPS**GRGRGIP*RLLLRTTPWAQQRPTPN*WAGGAGPDVRPPQAPPQHCRAGTAS 409
           E L EP   G G G+P R   R +P   +R TP    G   P   PPQ  P+  R G++ 
Sbjct: 441 ESLLEPRERGPGTGLPERP--RESPQLHERETPQPEGGPPSPAGTPPQ--PKRPRPGSSK 496

Query: 410 NGAA*VGEWT----GRSSRP 457
           +G    G W     G  SRP
Sbjct: 497 DGLLSPGAWNGEPGGEGSRP 516

>ref|NP_067541.1| junctophilin 2 [Mus musculus] gi|27805488|sp|Q9ET78|JPH2_MOUSE
           Junctophilin 2 (Junctophilin type 2) (JP-2)
           gi|9927303|dbj|BAB12044.1| junctophilin type 2 [Mus
           musculus]
          Length = 696

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 29/80 (36%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = +2

Query: 230 EPLDEPS**GRGRGIP*RLLLRTTPWAQQRPTPN*WAGGAGPDVRPPQAPPQHCRAGTAS 409
           E L EP   G G G+P R   R +P   +R TP    G   P   PPQ  P+  R G + 
Sbjct: 441 ESLLEPPERGLGTGLPERP--RESPQLHERETPQPEGGPPSPAGTPPQ--PKRPRPGASK 496

Query: 410 NGAA*VGEWT----GRSSRP 457
           +G    G W     G  SRP
Sbjct: 497 DGLLSPGSWNGEPGGEGSRP 516

>ref|NP_079192.1| hypothetical protein FLJ22814 [Homo sapiens]
           gi|10439338|dbj|BAB15489.1| unnamed protein product
           [Homo sapiens]
          Length = 240

 Score = 35.4 bits (80), Expect = 0.39
 Identities = 19/44 (43%), Positives = 21/44 (47%)
 Frame = -3

Query: 432 SPTHAAPFEAVPALQCCGGA*GGRTSGPAPPAH*FGVGLCWAQG 301
           SPTHA   + VP     GG    R +GPAP       G CW QG
Sbjct: 168 SPTHAGMLQPVPEQVVAGGCWQRRDNGPAPG------GKCWLQG 205

>pir||JC6316 probable protein kinase (EC 2.7.1.-) - fruit fly (Drosophila
           melanogaster)
          Length = 1102

 Score = 35.4 bits (80), Expect = 0.39
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = +2

Query: 314 QRPTPN*WAGGAGPDVRPPQAPPQHCR--AGTASNGAA*VGEWTGRSSRPRRVLP 472
           Q+P P   AGG G     P+APP++ R  +G +S+G +  G   G SS+P   LP
Sbjct: 530 QQPQPQTAAGGQGSQQAQPEAPPRNNRQSSGLSSSGGSASG--GGGSSKPAAALP 582

>ref|NP_032926.1| POU domain, class 3, transcription factor 3 [Mus musculus]
           gi|399131|sp|P31361|PO33_MOUSE POU domain, class 3,
           transcription factor 3 (Brain-specific homeobox/POU
           domain protein 1) (Brain-1) (Brn-1 protein)
           gi|423400|pir||S31223 transcription factor Brn-1 - mouse
           gi|200445|gb|AAA39960.1| Brain-1 class III POU-domain
           protein
          Length = 495

 Score = 35.0 bits (79), Expect = 0.51
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 3/84 (3%)
 Frame = -2

Query: 337 PLVRGGPLLGPGSGSEKEPSRDTTPTPLS-GRFVKRFVYRFCSSTFRYPELKKARGSR-- 167
           P   GG   GPG  S    S + TPT     +F K+F  R     F   ++  A G+   
Sbjct: 288 PPHHGGGGAGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG 347

Query: 166 SVLGHTTLCRVEAVASAFAFESLC 95
           +V   TT+CR EA+    +F+++C
Sbjct: 348 NVFSQTTICRFEAL--QLSFKNMC 369



EST assemble image


clone accession position
1 LCL097f10_r AV631655 1 118
2 HCL059f05_r AV642871 13 497
3 CL16e04_r AV394011 24 497




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research