KCC000283A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000283A_C01 KCC000283A_c01
GCCGTGTTTGCCCATACCACTTCCCCTCTGGGCGCGTCGTAGCGTCGTTGGTGCCTAGTG
TAAGCGGCAGGAGCCCAGCGTCTCCTCTCCATCTCGGTATAACCCTCGCCCGTCCCGGAA
AGGGTCCCGACAACATGGCCAAGGAGGAGAAGAACTTCATGGTGGACTTCCTGGCCGGCG
GCCTCTCTGCTGCCGTGTCCAAGACAGCTGCCGCGCCTATTGAGCTGTGTGAAGCTGCTG
ATCCAGAACCAGGATGAGATGATCAAGCAGGGCCGCCTGCGCTTCCCCCTACAAGGGCAT
CGGCGAGTGCTTCGTGCGCACCGTCCGCGAGGAGGGTTTTGGCTCGCTGTGGCGCGGCAA
CACCGCCAACGTGATTCGCTACTTCCCCACCCAGGCCCTGGAACTTCGCTTTCAAGGATA
AGTTCAAGCGCATGTTCGGCTTCAACAAGGACAAGGAGTACTGGAAGTGGTTCGCGGGCA
ACATGGCCTCGGGCGGTGCTGCCGGCGCTGTGTCGCTGTCGTTCGTCTACTCGCTGGACT
ACGCCCGTACCCGTCTGGCCAACGACGCGAAGTCGGCCAAGAAGGGTGGCGGAGACCGCC
AGTTCAACGGCCTGGTGGACGTGTACCGCAAGACCATCGCCTCCGACGGCATTGCGGGCC
TGTACCGCGGCTTCAACATCTCGTGCGTGGGCATTGTTGTGTACCGCGGCCTGTACTTCG
GCATGTACGACTCGCTGAAGCCCGTGGTGCTGGTCGGCCCCCTGGCCAACAACTTCCTGG
CGGCTTTCCTGCTGGGCTGGGGCATCACCATCGGCGCCGGCCTGGCGTCCTACCCCATCG
ACACCATTCGTCGTCGCATGATGATGACCTCGGGCTCCGCTGTCAAGTACAACAGCTCGT
TCCACTGCTTCCAGGAGATCGTGAAGAACGAGGGCATGAAGTCGCTCTTCAAGGGCGCGG
GCGCCAACATCCTGCGTGCCGTGGCTGGCGCCGGTGTGCTGGCGGGCTACGACCAGCTGC
AGGTCATCCTGCTGGGCAAGAAGTACGGCAGCGGCGAGGCCTAAAGCGGCCATTGCATGC
CTGGAGCTATTGCTAAGAGGCGGCGCTCGGATGAGGGGTACAACAGCTTCGCAACCTGGG
TTTGCTCTCCTAATTCTTTACCATATGCAGTGCGAGTGAGTGTTAATTACCGTGGAACCG
TGGACACTGACATGGCTGCGGACCAGCAGTGACAACGGAGGCTTGTGTGCGTGTGTGGCA
TGTGGTGATGGTAGCGATAACGTGCACTCGAAGAATGCTATCAACCTCCCAAAGACACCC
ATAGCATGGGTCTGTGGTTGGTGCATTCCGGGTTTAGGCTAGATGGATTACGGAACCATC
GTAAGATTGGCATATGAAAGCCGAATGCGGATGAGGCGGAGCATGGACCGGATGTTTCGG
ACGTTCTGTAACACAGACGCGGGCAAAAAAAAAAAAAAAAAAAActcgtgc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000283A_C01 KCC000283A_c01
         (1491 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P27080|ADT_CHLRE ADP,ATP carrier protein (ADP/ATP translocase...   481  e-134
ref|NP_194568.1| mitochondrial ADP,ATP carrier protein, putative...   392  e-108
sp|P31691|ADT_ORYSA ADP,ATP carrier protein, mitochondrial precu...   387  e-106
gb|AAM65696.1| ADP,ATP carrier-like protein [Arabidopsis thaliana]    386  e-106
sp|P12857|ADT2_MAIZE ADP,ATP carrier protein 2, mitochondrial pr...   385  e-105

>sp|P27080|ADT_CHLRE ADP,ATP carrier protein (ADP/ATP translocase) (Adenine nucleotide
            translocator) (ANT) gi|419739|pir||S30259 ADP,ATP carrier
            protein, mitochondrial - Chlamydomonas reinhardtii
            gi|18110|emb|CAA46311.1| mitochondrial ADP/ATP
            translocator protein [Chlamydomonas reinhardtii]
            gi|446768|prf||1912294A ADP/ATP translocator
          Length = 308

 Score =  481 bits (1238), Expect = e-134
 Identities = 254/309 (82%), Positives = 258/309 (83%)
 Frame = +3

Query: 135  MAKEEKNFMVDFLAGGLSAAVSKTAAAPIELCEAADPEPG*DDQAGPPALPPTRASASAS 314
            MAKEEKNFMVDFLAGGLSAAVSKTAAAPIE  +          + G  A  P +      
Sbjct: 1    MAKEEKNFMVDFLAGGLSAAVSKTAAAPIERVKLLIQNQDEMIKQGRLA-SPYKGIGECF 59

Query: 315  CAPSARRVLARCGAATPPT*FATSPPRPWNFAFKDKFKRMFGFNKDKEYWKWFAGNMASG 494
                                    P +  NFAFKDKFKRMFGFNKDKEYWKWFAGNMASG
Sbjct: 60   VRTVREEGFGSLWRGNTANVIRYFPTQALNFAFKDKFKRMFGFNKDKEYWKWFAGNMASG 119

Query: 495  GAAGAVSLSFVYSLDYARTRLANDAKSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGF 674
            GAAGAVSLSFVYSLDYARTRLANDAKSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGF
Sbjct: 120  GAAGAVSLSFVYSLDYARTRLANDAKSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGF 179

Query: 675  NISCVGIVVYRGLYFGMYDSLKPVVLVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRR 854
            NISCVGIVVYRGLYFGMYDSLKPVVLVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRR
Sbjct: 180  NISCVGIVVYRGLYFGMYDSLKPVVLVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRR 239

Query: 855  RMMMTSGSAVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILL 1034
            RMMMTSGSAVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILL
Sbjct: 240  RMMMTSGSAVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILL 299

Query: 1035 GKKYGSGEA 1061
            GKKYGSGEA
Sbjct: 300  GKKYGSGEA 308

 Score = 90.1 bits (222), Expect(2) = 1e-22
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +2

Query: 281 ASPYKGIGECFVRTVREEGFGSLWRGNTANVIRYFPTQALELRFQ 415
           ASPYKGIGECFVRTVREEGFGSLWRGNTANVIRYFPTQAL   F+
Sbjct: 49  ASPYKGIGECFVRTVREEGFGSLWRGNTANVIRYFPTQALNFAFK 93

 Score = 40.0 bits (92), Expect(2) = 1e-22
 Identities = 19/23 (82%), Positives = 20/23 (86%)
 Frame = +1

Query: 229 VKLLIQNQDEMIKQGRLRFPLQG 297
           VKLLIQNQDEMIKQGRL  P +G
Sbjct: 32  VKLLIQNQDEMIKQGRLASPYKG 54

>ref|NP_194568.1| mitochondrial ADP,ATP carrier protein, putative [Arabidopsis
            thaliana] gi|7441721|pir||T04608 ADP,ATP carrier protein
            F20O9.60 - Arabidopsis thaliana
            gi|2842480|emb|CAA16877.1| ADP, ATP carrier-like protein
            [Arabidopsis thaliana] gi|7269693|emb|CAB79641.1| ADP,
            ATP carrier-like protein [Arabidopsis thaliana]
            gi|26451091|dbj|BAC42650.1| putative ADP,ATP carrier
            [Arabidopsis thaliana]
          Length = 379

 Score =  392 bits (1007), Expect = e-108
 Identities = 212/306 (69%), Positives = 237/306 (77%), Gaps = 1/306 (0%)
 Frame = +3

Query: 141  KEEKNFMVDFLAGGLSAAVSKTAAAPIELCEAADPEPG*DDQAGPPALPPTRASASASCA 320
            K    F++DFL GG+SAAVSKTAAAPIE  +          +AG  + P    S   +  
Sbjct: 74   KTGTGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFART 133

Query: 321  PSARRVLARCGAATPPT*FATSPPRPWNFAFKDKFKRMFGFNKDKE-YWKWFAGNMASGG 497
                 +LA     T        P +  NFAFKD FKR+F F K+K+ YWKWFAGN+ASGG
Sbjct: 134  VKDEGMLALWRGNTANV-IRYFPTQALNFAFKDYFKRLFNFKKEKDGYWKWFAGNLASGG 192

Query: 498  AAGAVSLSFVYSLDYARTRLANDAKSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGFN 677
            AAGA SL FVYSLDYARTRLANDAK+AKKGG  RQFNG+VDVY+KTIASDGI GLYRGFN
Sbjct: 193  AAGASSLLFVYSLDYARTRLANDAKAAKKGG-QRQFNGMVDVYKKTIASDGIVGLYRGFN 251

Query: 678  ISCVGIVVYRGLYFGMYDSLKPVVLVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRRR 857
            ISCVGIVVYRGLYFG+YDSLKPVVLV  L ++FLA+FLLGWGITIGAGLASYPIDT+RRR
Sbjct: 252  ISCVGIVVYRGLYFGLYDSLKPVVLVDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRR 311

Query: 858  MMMTSGSAVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILLG 1037
            MMMTSG AVKY SS   F +IVKNEG KSLFKGAGANILRAVAGAGVLAGYD+LQ+I+LG
Sbjct: 312  MMMTSGEAVKYKSSLQAFSQIVKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLG 371

Query: 1038 KKYGSG 1055
            KKYGSG
Sbjct: 372  KKYGSG 377

 Score = 72.8 bits (177), Expect(2) = 1e-16
 Identities = 31/45 (68%), Positives = 37/45 (81%)
 Frame = +2

Query: 281 ASPYKGIGECFVRTVREEGFGSLWRGNTANVIRYFPTQALELRFQ 415
           + PYKGI +CF RTV++EG  +LWRGNTANVIRYFPTQAL   F+
Sbjct: 120 SEPYKGISDCFARTVKDEGMLALWRGNTANVIRYFPTQALNFAFK 164

 Score = 37.4 bits (85), Expect(2) = 1e-16
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = +1

Query: 229 VKLLIQNQDEMIKQGRLRFPLQG 297
           VKLLIQNQDEMIK GRL  P +G
Sbjct: 103 VKLLIQNQDEMIKAGRLSEPYKG 125

>sp|P31691|ADT_ORYSA ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP
            translocase) (Adenine nucleotide translocator) (ANT)
            gi|218145|dbj|BAA02161.1| ATP/ADP translocator [Oryza
            sativa (japonica cultivar-group)]
          Length = 382

 Score =  387 bits (995), Expect = e-106
 Identities = 207/308 (67%), Positives = 230/308 (74%), Gaps = 1/308 (0%)
 Frame = +3

Query: 141  KEEKNFMVDFLAGGLSAAVSKTAAAPIELCEAADPEPG*DDQAGPPALPPTRASASASCA 320
            K  KNFM+DFL GG+SAAVSKTAAAPIE  +          +AG  +  P +        
Sbjct: 77   KGGKNFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLS-EPYKGIGDCFGR 135

Query: 321  PSARRVLARCGAATPPT*FATSPPRPWNFAFKDKFKRMFGFNKDKE-YWKWFAGNMASGG 497
                   A              P +  NFAFKD FKR+F F KDK+ YWKWF GN+ASGG
Sbjct: 136  TIKDEGFASLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDKDGYWKWFGGNLASGG 195

Query: 498  AAGAVSLSFVYSLDYARTRLANDAKSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGFN 677
            AAGA SL FVYSLDYARTRLANDAK+AK GGG+RQFNGLVDVYRKT+ SDGIAGLYRGFN
Sbjct: 196  AAGASSLFFVYSLDYARTRLANDAKAAK-GGGERQFNGLVDVYRKTLKSDGIAGLYRGFN 254

Query: 678  ISCVGIVVYRGLYFGMYDSLKPVVLVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRRR 857
            ISCVGI+VYRGLYFGMYDSLKPVVL G L +NF A+F LGW IT GAGLASYPIDT+RRR
Sbjct: 255  ISCVGIIVYRGLYFGMYDSLKPVVLTGSLQDNFFASFALGWLITNGAGLASYPIDTVRRR 314

Query: 858  MMMTSGSAVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILLG 1037
            MMMTSG AVKY SS   F +I+KNEG KSLFKGAGANILRA+AGAGVL+GYDQLQ++  G
Sbjct: 315  MMMTSGEAVKYKSSMDAFSQILKNEGAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFG 374

Query: 1038 KKYGSGEA 1061
            KKYGSG A
Sbjct: 375  KKYGSGGA 382

 Score = 78.6 bits (192), Expect(2) = 2e-18
 Identities = 33/45 (73%), Positives = 39/45 (86%)
 Frame = +2

Query: 281 ASPYKGIGECFVRTVREEGFGSLWRGNTANVIRYFPTQALELRFQ 415
           + PYKGIG+CF RT+++EGF SLWRGNTANVIRYFPTQAL   F+
Sbjct: 123 SEPYKGIGDCFGRTIKDEGFASLWRGNTANVIRYFPTQALNFAFK 167

 Score = 37.4 bits (85), Expect(2) = 2e-18
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = +1

Query: 229 VKLLIQNQDEMIKQGRLRFPLQG 297
           VKLLIQNQDEMIK GRL  P +G
Sbjct: 106 VKLLIQNQDEMIKAGRLSEPYKG 128

>gb|AAM65696.1| ADP,ATP carrier-like protein [Arabidopsis thaliana]
          Length = 379

 Score =  386 bits (992), Expect = e-106
 Identities = 210/306 (68%), Positives = 235/306 (76%), Gaps = 1/306 (0%)
 Frame = +3

Query: 141  KEEKNFMVDFLAGGLSAAVSKTAAAPIELCEAADPEPG*DDQAGPPALPPTRASASASCA 320
            K    F++ FL GG+SAAVSKTAAAPIE  +          +AG  + P    S   +  
Sbjct: 74   KTGTGFLIYFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFART 133

Query: 321  PSARRVLARCGAATPPT*FATSPPRPWNFAFKDKFKRMFGFNKDKE-YWKWFAGNMASGG 497
                 +LA     T        P +  NFAFKD FKR+F F K+K+ YWKWFAGN+ASGG
Sbjct: 134  VKDEGMLALWRGNTANV-IRYFPTQALNFAFKDYFKRLFNFKKEKDGYWKWFAGNLASGG 192

Query: 498  AAGAVSLSFVYSLDYARTRLANDAKSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGFN 677
            AAGA SL FVYSLDYARTRLANDAK+AKKGG  RQFNG+VDVY+KTIASDGI GLYRGFN
Sbjct: 193  AAGASSLLFVYSLDYARTRLANDAKAAKKGG-QRQFNGMVDVYKKTIASDGIVGLYRGFN 251

Query: 678  ISCVGIVVYRGLYFGMYDSLKPVVLVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRRR 857
            ISCVGIVVYRGLYFG+YDSLKPVVLV  L ++FLA+FLLGWGITIGAGLASYPIDT+RR 
Sbjct: 252  ISCVGIVVYRGLYFGLYDSLKPVVLVDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRX 311

Query: 858  MMMTSGSAVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILLG 1037
            MMMTSG AVKY SS   F +IVKNEG KSLFKGAGANILRAVAGAGVLAGYD+LQ+I+LG
Sbjct: 312  MMMTSGEAVKYKSSLQAFSQIVKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLG 371

Query: 1038 KKYGSG 1055
            KKYGSG
Sbjct: 372  KKYGSG 377

 Score = 72.8 bits (177), Expect(2) = 1e-16
 Identities = 31/45 (68%), Positives = 37/45 (81%)
 Frame = +2

Query: 281 ASPYKGIGECFVRTVREEGFGSLWRGNTANVIRYFPTQALELRFQ 415
           + PYKGI +CF RTV++EG  +LWRGNTANVIRYFPTQAL   F+
Sbjct: 120 SEPYKGISDCFARTVKDEGMLALWRGNTANVIRYFPTQALNFAFK 164

 Score = 37.4 bits (85), Expect(2) = 1e-16
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = +1

Query: 229 VKLLIQNQDEMIKQGRLRFPLQG 297
           VKLLIQNQDEMIK GRL  P +G
Sbjct: 103 VKLLIQNQDEMIKAGRLSEPYKG 125

>sp|P12857|ADT2_MAIZE ADP,ATP carrier protein 2, mitochondrial precursor (ADP/ATP
            translocase 2) (Adenine nucleotide translocator 2) (ANT
            2) gi|100851|pir||S16568 ADP,ATP carrier protein G2 -
            maize gi|22164|emb|CAA41812.1| adenine nucleotide
            translocator [Zea mays]
          Length = 387

 Score =  385 bits (989), Expect = e-105
 Identities = 204/308 (66%), Positives = 232/308 (75%), Gaps = 1/308 (0%)
 Frame = +3

Query: 141  KEEKNFMVDFLAGGLSAAVSKTAAAPIELCEAADPEPG*DDQAGPPALPPTRASASASCA 320
            K  KNFM+DF+ GG+SAAVSKTAAAPIE  +          ++G  +  P +  A     
Sbjct: 82   KGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLS-EPYKGIADCFKR 140

Query: 321  PSARRVLARCGAATPPT*FATSPPRPWNFAFKDKFKRMFGFNKDKE-YWKWFAGNMASGG 497
                   +              P +  NFAFKD FKR+F F KD++ YWKWFAGN+ASGG
Sbjct: 141  TIKDEGFSSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGG 200

Query: 498  AAGAVSLSFVYSLDYARTRLANDAKSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGFN 677
            AAGA SL FVYSLDYARTRLANDAK+AK GGGDRQFNGLVDVYRKT+ SDGIAGLYRGFN
Sbjct: 201  AAGASSLFFVYSLDYARTRLANDAKAAK-GGGDRQFNGLVDVYRKTLKSDGIAGLYRGFN 259

Query: 678  ISCVGIVVYRGLYFGMYDSLKPVVLVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRRR 857
            ISCVGI+VYRGLYFG+YDS+KPVVL G L +NF A+F LGW IT GAGLASYPIDT+RRR
Sbjct: 260  ISCVGIIVYRGLYFGLYDSIKPVVLTGSLQDNFFASFALGWLITNGAGLASYPIDTVRRR 319

Query: 858  MMMTSGSAVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILLG 1037
            MMMTSG AVKY SS   FQ+I+K EG KSLFKGAGANILRA+AGAGVL+GYDQLQ++  G
Sbjct: 320  MMMTSGEAVKYKSSLDAFQQILKKEGPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFG 379

Query: 1038 KKYGSGEA 1061
            KKYGSG A
Sbjct: 380  KKYGSGGA 387

 Score = 76.6 bits (187), Expect(2) = 7e-18
 Identities = 32/45 (71%), Positives = 38/45 (84%)
 Frame = +2

Query: 281 ASPYKGIGECFVRTVREEGFGSLWRGNTANVIRYFPTQALELRFQ 415
           + PYKGI +CF RT+++EGF SLWRGNTANVIRYFPTQAL   F+
Sbjct: 128 SEPYKGIADCFKRTIKDEGFSSLWRGNTANVIRYFPTQALNFAFK 172

 Score = 37.7 bits (86), Expect(2) = 7e-18
 Identities = 18/23 (78%), Positives = 19/23 (82%)
 Frame = +1

Query: 229 VKLLIQNQDEMIKQGRLRFPLQG 297
           VKLLIQNQDEMIK GRL  P +G
Sbjct: 111 VKLLIQNQDEMIKSGRLSEPYKG 133



EST assemble image


clone accession position
1 HC049c09_r AV635666 1 589
2 HC020e09_r AV633415 24 612
3 HC069h06_r AV637184 29 590
4 MX015g05_r BP086742 30 529
5 LCL024h08_r AV627318 107 447
6 LC048a07_r AV622316 110 656
7 CM093b04_r AV392965 111 665
8 CM028b08_r AV387733 111 706
9 CM069e10_r AV391226 113 743
10 MX209e03_r BP089547 115 433
11 MX212g07_r BP089713 116 580
12 CM086d04_r AV392546 117 623
13 CM061b05_r AV390584 117 749
14 CM030h09_r AV397398 117 760
15 CM036b06_r AV388814 117 399
16 CM017b06_r AV388168 117 717
17 MXL042b02_r BP095458 118 520
18 HC039g05_r AV634927 118 696
19 CM009f05_r AV397701 118 747
20 HC033e09_r AV634451 118 623
21 LC076c01_r AV624328 118 696
22 HC006a03_r AV632263 118 568
23 LCL044e02_r AV628607 118 387
24 HC063a02_r AV636692 118 640
25 LC082h11_r AV624800 118 612
26 MX022b05_r BP086985 119 529
27 LCL065g11_r AV629771 119 527
28 LC036c12_r AV621452 119 614
29 HC025f02_r AV633813 121 651
30 HC074e05_r AV637549 123 627
31 CM093f03_r AV392971 123 709
32 MX255d09_r BP092529 125 449
33 HC058c05_r AV636342 125 687
34 HC008c04_r AV632438 125 628
35 MX254h08_r BP092494 125 671
36 LC041g05_r AV621852 126 686
37 LC083e11_r AV624849 128 690
38 HC091g04_r AV638860 128 562
39 HC088e12_r AV638615 128 649
40 CM017b08_r AV388193 128 728
41 HC069f08_r AV637167 130 597
42 HC083h01_r AV638248 131 576
43 CM084a06_r AV392607 133 704
44 CM006f10_r AV387201 133 679
45 CM042g06_r AV389262 138 349
46 LC019a09_r AV620208 142 687
47 MX211b06_r BP089638 161 640
48 HC031b04_r AV634258 161 669
49 HC076b07_r AV637680 174 806
50 HC063g11_r AV636758 184 677
51 LC057f12_r AV623006 283 826
52 CM091b12_r AV397557 298 612
53 MX248d01_r BP092013 301 601
54 MX014e12_r BP086696 358 880
55 MX231c02_r BP090931 385 756
56 HC044c06_r AV635276 398 874
57 LC095a03_r AV625584 424 795
58 CM019a05_r AV387297 431 919
59 MX102h03_r BP088934 531 1036
60 MX103e06_r BP088990 531 1065
61 MX104g11_r BP089103 531 1038
62 MX104b12_r BP089047 531 1041
63 CM034g12_r AV388663 531 1102
64 MX104f05_r BP089086 531 908
65 LC096a08_r AV625656 561 1026
66 LC013a07_r AV619776 579 1119
67 MXL005g03_r BP093256 588 1072
68 CM038d11_r AV389016 596 903
69 CL16d12_r AV394023 611 1100
70 HC034f05_r AV634532 804 1391
71 MXL024b06_r BP094505 1005 1385
72 MX058f02_r BP088359 1007 1338
73 CM080d11_r AV392035 1016 1613
74 CM074a02_r AV391509 1036 1616
75 CM023c12_r AV387767 1055 1640
76 MX059b09_r BP088387 1068 1212
77 CM099g06_r AV393128 1112 1612
78 HC048c04_r AV635591 1115 1645
79 HC025h06_r AV633835 1174 1613
80 CM050d08_r AV389751 1431 1668




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research