KCC000282A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000282A_C01 KCC000282A_c01
gcggGTTGCTGCGCGTGAGGATATATCCAATCACTGTGCATCGGAACTGAAACACCAGCA
GCGGGCTGCTGAGCCGATCAGCTGCGAACATCTATAACTCCCAGTCAGATAGATCGCATT
ACTCGGGTTGCACCATGGCGCCTGTAGGGCTTGACACGAGCAGCCCATCCAGCGGGTCCT
CCTGGTTCAAAGTTGCAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000282A_C01 KCC000282A_c01
         (198 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_498711.1| tyrosinase and metridin-like ShK toxin family m...    33  0.96
pir||S44739 C02C2.1 protein - Caenorhabditis elegans                   33  0.96
ref|NP_571169.1| human E12 homolog [Danio rerio] gi|2118448|pir|...    31  4.8

>ref|NP_498711.1| tyrosinase and metridin-like ShK toxin family member (68.4 kD)
           (3I965) [Caenorhabditis elegans]
           gi|21903491|sp|P34269|YKH1_CAEEL Hypothetical
           tyrosinase-like protein C02C2.1 in chromosome III
           gi|14625116|gb|AAA27909.2| Hypothetical protein C02C2.1
           [Caenorhabditis elegans]
          Length = 601

 Score = 33.5 bits (75), Expect = 0.96
 Identities = 18/50 (36%), Positives = 24/50 (48%)
 Frame = -1

Query: 186 TRRTRWMGCSCQALQAPWCNPSNAIYLTGSYRCSQLIGSAARCWCFSSDA 37
           TRR +WM  +CQA    WCN + A       R S+ +   A+ W    DA
Sbjct: 540 TRRRQWMAENCQA-TCGWCNMNEAQLCASVARQSRRVRRNAKFWLTEPDA 588

>pir||S44739 C02C2.1 protein - Caenorhabditis elegans
          Length = 484

 Score = 33.5 bits (75), Expect = 0.96
 Identities = 18/50 (36%), Positives = 24/50 (48%)
 Frame = -1

Query: 186 TRRTRWMGCSCQALQAPWCNPSNAIYLTGSYRCSQLIGSAARCWCFSSDA 37
           TRR +WM  +CQA    WCN + A       R S+ +   A+ W    DA
Sbjct: 423 TRRRQWMAENCQA-TCGWCNMNEAQLCASVARQSRRVRRNAKFWLTEPDA 471

>ref|NP_571169.1| human E12 homolog [Danio rerio] gi|2118448|pir||I50518 DNA binding
           protein E12 - zebra fish gi|509754|emb|CAA54305.1| DNA
           binding protein E12 [Danio rerio]
          Length = 583

 Score = 31.2 bits (69), Expect = 4.8
 Identities = 15/49 (30%), Positives = 27/49 (54%)
 Frame = +3

Query: 45  N*NTSSGLLSRSAANIYNSQSDRSHYSGCTMAPVGLDTSSPSSGSSWFK 191
           N  +S   + ++ A+IY S ++ S++S     PVG  ++  +S S W K
Sbjct: 259 NAGSSGAEIGKALASIYPSDNNGSNFSSTPSTPVGSPSNVAASASQWPK 307

  Database: nr
    Posted date:  Oct 14, 2003 12:26 AM
  Number of letters in database: 498,525,298
  Number of sequences in database:  1,537,769
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 195,834,172
Number of Sequences: 1537769
Number of extensions: 3193768
Number of successful extensions: 8445
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 8230
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8445
length of database: 498,525,298
effective HSP length: 41
effective length of database: 435,476,769
effective search space used: 10451442456
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 CL16d06_r AV394032 1 137
2 LC035g11_r AV621418 5 198




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research