KCC000281A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000281A_C01 KCC000281A_c01
cttcgccaaggccatctaccgcgcctacacagacagcagcttcaacaccctcgccaccac
gcccgctgaatggcagcaccTGGGCAACGTGGGCCCCGTCATGTACGGCGCCGTGGGTCA
GGTCATTCGCGTGGTGTTCAAGAACAACCTGGACTTCCCCGTCAACATGGCTCCCAGCGG
CGGCCTGATCGCCTGGGACGGCAACGGCCGCCGCTCCGCCCGCATCGACCCCGTGAAGCC
CGGGCAGACAGTCACCTACCTGTGGCAGATCCCCGAGGACGCTGGCCCGGTGGCCAACGC
CACTGTGACCAGCCGCCTGTGGCTGTACCGCAGTAGCGTGGACCCGCAGAAGCACGACAA
CGCAGGACTGGTGGGCCCCATCATCGTCACCTCCGCCGCCAACGCCGACGCCAACGGCCG
CGCCCGCGACGTGGACCGCGACGTGGTGGCCATCTTCCAGCTTGTGCAGGAGCGCGCCAG
CCCGCTGCTGTTCCAGGAGGACACCAGCCTCACCGCCGGCACCTCCTACACCAAGATGGC
CATCAACGGCTACACCTGGTGCAACATGCCCGACGGTGCCATCACCATCAAGACCGGCGA
GCGGGTGCGGTGGCACGTGGCCTCCATTGGCTCGTCGGAGTCGCTGCACAACTTCCACTG
GCACGGACACGTGGTGGAGCTCAACGGGCACCATGTGGACCAGTTCACCGCCATCCCCAC
CGCCACCTACTCGGTCAACATGGTGCCGGACGAGCCCGGCACCTGGATGTTCCACTGCCA
CGTTAACTTCCACATGGACGGCGGCATGGTCGCCCTCTACACCGTCACCGGCGACCCCGC
GCCCCTGCCCACCGGCGGCGTGGAGCGGGTGTACTACGTGCTGCGCGCAGGAGGTTGAGT
GGAGCTACAGCGGCCCCAACAACACCCAGGCCTGCGCCGCTGCCCGAGCTGCAGTTCTCC
AGCGAGCCCGGCAGTGAGGAGGTGAACGGCAATGTGTTCCTGGAGGGTCCCTCCACCGAC
CCCGTGCGCCTGGGACACATCTACACCAAGACGCTGCTGATCGAGTACACGGACGCGAGC
TTCACCACCGTCAAGCCGCTGGCCGGCGGACGAGCAGTACCTGGGGCTGCTGGTGTGCCG
GTCATGCGGGCCAACGTGGGGGACACCATCAAGGTGGTGCTGAAGAACGACGCCAAGATC
GACGTGAGCCTGCACCCTCACGGTGTGCGCTACAGCAAGGCCAACGAGGGCACGCTGTAC
GAGGACGGCACCAGCTGGCTGCCGACAAGGCTGACGACTGTGGTGGCTGCCCGGCACCAC
CTACACCTACGTCTGGAACGTTCCTGACCGCGCCGGCCCCGGCCCGTGCGACCCCAGCTC
CATGCTGTGGATGTACCACTCCCACATCGACGAGACCGCGGAGACCTACGCCGGTGTGGC
GGGAGGCATCATCGTCACCGCCAAGGACATGGCCCGCAGCACTGCCGACCTGACGCCCAA
GGACGTGGACCGCGAAATTGTCATCTTCTTTACCGTGGTGGATGAGATCAAGTCCTCCAA
CTTCATGGAGAACCTGGCCAACAAGCTGGGCGACGGCGGCGCGCTGGCGGCCCAGCTGGC
GGCCAACGCCACCGAGATGACTGCGCTGGTGACCGACCCCGTCTTCATGGAGCACATGCT
CAAGCACGGCATCAACGGCCACATGTACTGCCACATGCCCCGCCTCACCTTCGAGCAGGG
CGACAAGGTCCGGCTGCACGTGATGGTGCTGGGCACGCTGGAGGACATGCACACGCCCAA
CATGGGCGGCCCGCGGTTCTGACTACAACGGCATGCACACCGACTCCATCCAGATCAGCC
CGGGCGGCATGGTCAGCGCCGACGTGCAGATGACCTCGCCGGGCGACTACGAGCTGCAGT
GCCGTGTGTGCGGACCACGTGATGGCGGGCATGCGCGCCAAGTACACCGTCACCGCCAAC
GCCAGCCGCATGGTGGTCAACCCCTCGGGCGTCACCCGCACCTACTACATCCAGGCAGAG
GCCGTCAACTGGGACTACGCGCCCGCAGGCTACC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000281A_C01 KCC000281A_c01
         (2074 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM45881.1|AF450137_1 multicopper ferroxidase [Chlamydomonas ...   941  0.0
gb|AAQ89349.1| HEPH [Homo sapiens]                                    157  4e-66
ref|NP_620074.1| hephaestin isoform a [Homo sapiens] gi|12830539...   157  4e-66
dbj|BAA31673.2| KIAA0698 protein [Homo sapiens]                       157  4e-66
emb|CAC35365.2| hephaestin [Homo sapiens]                             157  1e-65

>gb|AAM45881.1|AF450137_1 multicopper ferroxidase [Chlamydomonas reinhardtii]
            gi|25989441|gb|AAL78162.1| ferroxidase-like protein
            [Chlamydomonas reinhardtii]
          Length = 1142

 Score =  941 bits (2431), Expect(3) = 0.0
 Identities = 490/627 (78%), Positives = 506/627 (80%), Gaps = 21/627 (3%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
            FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG
Sbjct: 137  FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 196

Query: 182  GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSSVDPQKHDN 361
            GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSSVDPQKHDN
Sbjct: 197  GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSSVDPQKHDN 256

Query: 362  AGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPLLFQEDTSLTAGTSYTKMA 541
            AGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPLLFQEDTSLTAGTSYTKMA
Sbjct: 257  AGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPLLFQEDTSLTAGTSYTKMA 316

Query: 542  INGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFHWHGHVVELNGHHVDQFTAIPT 721
            INGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFHWHGHVVELNGHHVDQFTAIPT
Sbjct: 317  INGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFHWHGHVVELNGHHVDQFTAIPT 376

Query: 722  ATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTVTGDPAPLPTGGVERVYYV------- 880
            ATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTVTGDPAPLPTGGVERVYYV       
Sbjct: 377  ATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTVTGDPAPLPTGGVERVYYVRAQEVEW 436

Query: 881  -------LRAGG*VELQRPQQHPGLRRCPS---CSSPASPAVRR*TAMCSWRVPPPTPCA 1030
                    +A    ELQ   + PG            P++  VR         +   T  +
Sbjct: 437  SYSGPNNTQACAVPELQFSSE-PGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDAS 495

Query: 1031 WDTSTPRRC*SSTRTRASPPSSRWPADEQYLGLLVCRSCGPTW----GTPSRWC*RTTPR 1198
            + T  PR                 PADEQYLGLL     GP      G   +   +   +
Sbjct: 496  FTTVKPR-----------------PADEQYLGLL-----GPVMRANVGDTIKVVLKNDAK 533

Query: 1199 ST*ACTLTVCATARPTRARCTRTAPAGCRQG*RLWWLPGTTYTYVWNVPDRAGPGPCDPS 1378
               +        ++           +G  +   +   PGTTYTYVWNVPDRAGPGPCDPS
Sbjct: 534  IDVSLHPHGVRYSKANEGTLYEDGTSGADKADDV-VAPGTTYTYVWNVPDRAGPGPCDPS 592

Query: 1379 SMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTADLTPKDVDREIVIFFTVVDEIKSS 1558
            SMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTADLTPKDVDREIVIFFTVVDEIKSS
Sbjct: 593  SMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTADLTPKDVDREIVIFFTVVDEIKSS 652

Query: 1559 NFMENLANKLGDGGALAAQLAANATEMTALVTDPVFMEHMLKHGINGHMYCHMPRLTFEQ 1738
            NFMENLANKLGDGGALAAQLAANATEMTALVTDPVFMEHMLKHGINGHMYCHMPRLTFEQ
Sbjct: 653  NFMENLANKLGDGGALAAQLAANATEMTALVTDPVFMEHMLKHGINGHMYCHMPRLTFEQ 712

Query: 1739 GDKVRLHVMVLGTLEDMHTPNMGGPRF 1819
            GDKVRLHVMVLGTLEDMHTPNMGGPRF
Sbjct: 713  GDKVRLHVMVLGTLEDMHTPNMGGPRF 739

 Score =  199 bits (505), Expect = 2e-49
 Identities = 101/122 (82%), Positives = 104/122 (84%)
 Frame = +1

Query: 910  AAPTTPRPAPLPELQFSSEPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTT 1089
            + P   +   +PELQFSSEPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTT
Sbjct: 439  SGPNNTQACAVPELQFSSEPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTT 498

Query: 1090 VKPLAGGRAVPGAAGVPVMRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDG 1269
            VKP        G  G PVMRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDG
Sbjct: 499  VKPRPADEQYLGLLG-PVMRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDG 557

Query: 1270 TS 1275
            TS
Sbjct: 558  TS 559

 Score =  164 bits (415), Expect = 6e-39
 Identities = 108/330 (32%), Positives = 157/330 (46%), Gaps = 37/330 (11%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
            + K +   YTD+SF T+   PA+ Q+LG +GPVM   VG  I+VV KN+    V++ P G
Sbjct: 483  YTKTLLIEYTDASFTTVKPRPADEQYLGLLGPVMRANVGDTIKVVLKNDAKIDVSLHPHG 542

Query: 182  --------GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSS 337
                    G +  DG        D V PG T TY+W +P+ AGP      +S LW+Y S 
Sbjct: 543  VRYSKANEGTLYEDGTSGADKADDVVAPGTTYTYVWNVPDRAGP-GPCDPSSMLWMYHSH 601

Query: 338  VDPQKHDNAGLVGPIIVTSA--ANADANGRARDVDRDVVAIFQLVQERASPLLFQ----- 496
            +D      AG+ G IIVT+   A + A+   +DVDR++V  F +V E  S    +     
Sbjct: 602  IDETAETYAGVAGGIIVTAKDMARSTADLTPKDVDREIVIFFTVVDEIKSSNFMENLANK 661

Query: 497  ----------------EDTSLTAGTSYT----KMAINGYTWCNMPDGAITIKTGERVRWH 616
                            E T+L     +     K  ING+ +C+MP   +T + G++VR H
Sbjct: 662  LGDGGALAAQLAANATEMTALVTDPVFMEHMLKHGINGHMYCHMP--RLTFEQGDKVRLH 719

Query: 617  VASIGSSESLHNFHWHGHVVELNGHHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHM 796
            V  +G+ E +H  +  G   + NG H D     P    S ++    PG +   C V  H+
Sbjct: 720  VMVLGTLEDMHTPNMGGPRFDYNGMHTDSIQISPGGMVSADVQMTSPGDYELQCRVADHV 779

Query: 797  DGGMVALYTVTGDPAPLPT--GGVERVYYV 880
              GM A YTVT + + +     GV R YY+
Sbjct: 780  MAGMRAKYTVTANASRMVVNPSGVTRTYYI 809

 Score =  141 bits (356), Expect = 4e-32
 Identities = 93/300 (31%), Positives = 149/300 (49%), Gaps = 24/300 (8%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNL----DFPVNM 169
            + KA+YRAYTD++F+T   TPA   + G +GP++   VG  I V FKN +    ++P+N+
Sbjct: 850  YRKAVYRAYTDATFSTRVPTPA---YYGTMGPMIIAEVGDRIVVHFKNAVTDLEEYPLNI 906

Query: 170  APSGGLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSSVDPQ 349
            +P GGL+     G        V  G+T  Y W +P+ +GP   A   + ++ Y SSVD  
Sbjct: 907  SPGGGLLV---EGAADENCAEVAAGETCVYRWIVPDSSGP-GTADFNTAVYGYTSSVDVA 962

Query: 350  KHDNAGLVGPIIVTS----AANADANGRARDVDRDVVAIFQLVQERASPLL--------- 490
               +AGL G ++V       A  D +   R VD  V   +Q+V E +SP L         
Sbjct: 963  TAPSAGLAGALVVAGRGQLVAGPDGSLLPRGVDLMVPLYWQVVDENSSPFLDLNVEAAQL 1022

Query: 491  ----FQEDTSLTA--GTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHN 652
                F+ D  L+A         +INGY +CN P   +TI  G+++RW + + G+    H+
Sbjct: 1023 NVTKFENDAVLSADFDEGNRMHSINGYVYCNQP--LVTIAKGKKLRWVLVAYGTEGDFHS 1080

Query: 653  FHWHGHVVELNGHHVDQFTAI-PTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTVT 829
              + G  +E +        ++ P+     +M   + GTW+ +C V+ H   GM++ + VT
Sbjct: 1081 PQFTGQSLEADKSGYSTLASLMPSIARVADMTAADVGTWLLYCDVHDHYMAGMMSQFAVT 1140

 Score =  102 bits (253), Expect(3) = 0.0
 Identities = 48/48 (100%), Positives = 48/48 (100%)
 Frame = +1

Query: 1930 ADHVMAGMRAKYTVTANASRMVVNPSGVTRTYYIQAEAVNWDYAPAGY 2073
            ADHVMAGMRAKYTVTANASRMVVNPSGVTRTYYIQAEAVNWDYAPAGY
Sbjct: 776  ADHVMAGMRAKYTVTANASRMVVNPSGVTRTYYIQAEAVNWDYAPAGY 823

 Score = 88.6 bits (218), Expect(3) = 7e-21
 Identities = 57/168 (33%), Positives = 86/168 (50%), Gaps = 2/168 (1%)
 Frame = +2

Query: 1313 GTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKD--MARSTA 1486
            G T  Y W VPD +GPG  D ++ ++ Y S +D      AG+AG ++V  +   +A    
Sbjct: 928  GETCVYRWIVPDSSGPGTADFNTAVYGYTSSVDVATAPSAGLAGALVVAGRGQLVAGPDG 987

Query: 1487 DLTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVF 1666
             L P+ VD  + +++ VVDE  SS F+        D    AAQL     E  A+++   F
Sbjct: 988  SLLPRGVDLMVPLYWQVVDE-NSSPFL--------DLNVEAAQLNVTKFENDAVLSAD-F 1037

Query: 1667 MEHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMHTPNMGG 1810
             E    H ING++YC+ P +T  +G K+R  ++  GT  D H+P   G
Sbjct: 1038 DEGNRMHSINGYVYCNQPLVTIAKGKKLRWVLVAYGTEGDFHSPQFTG 1085

 Score = 81.6 bits (200), Expect(3) = 6e-25
 Identities = 59/186 (31%), Positives = 87/186 (46%), Gaps = 3/186 (1%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGP-GPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTA 1486
            PG T TY+W +P+ AGP      +S LW+Y S +D      AG+ G IIVT+   A + A
Sbjct: 216  PGQTVTYLWQIPEDAGPVANATVTSRLWLYRSSVDPQKHDNAGLVGPIIVTSA--ANADA 273

Query: 1487 DLTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVF 1666
            +   +DVDR++V  F +V E  S    +                     E T+L     +
Sbjct: 274  NGRARDVDRDVVAIFQLVQERASPLLFQ---------------------EDTSLTAGTSY 312

Query: 1667 MEHMLKHGINGHMYCHMP--RLTFEQGDKVRLHVMVLGTLEDMHTPNMGGPRF*LQRHAH 1840
                 K  ING+ +C+MP   +T + G++VR HV  +G+ E +H  +  G    L  H  
Sbjct: 313  T----KMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFHWHGHVVELNGH-- 366

Query: 1841 RLHPDQ 1858
              H DQ
Sbjct: 367  --HVDQ 370

 Score = 79.0 bits (193), Expect(3) = 0.0
 Identities = 36/36 (100%), Positives = 36/36 (100%)
 Frame = +3

Query: 1821 DYNGMHTDSIQISPGGMVSADVQMTSPGDYELQCRV 1928
            DYNGMHTDSIQISPGGMVSADVQMTSPGDYELQCRV
Sbjct: 740  DYNGMHTDSIQISPGGMVSADVQMTSPGDYELQCRV 775

 Score = 45.1 bits (105), Expect = 0.005
 Identities = 21/34 (61%), Positives = 21/34 (61%)
 Frame = +3

Query: 837 PRPCPPAAWSGCTTCCAQEVEWSYSGPNNTQACA 938
           P P P           AQEVEWSYSGPNNTQACA
Sbjct: 415 PAPLPTGGVERVYYVRAQEVEWSYSGPNNTQACA 448

 Score = 40.4 bits (93), Expect(3) = 6e-25
 Identities = 24/66 (36%), Positives = 33/66 (49%)
 Frame = +1

Query: 1027 RLGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPVMRANVGDTIKVVLKNDAKIDV 1206
            R+G  + K +   YTD+SF T+          G  G PVM   VG  I+VV KN+    V
Sbjct: 132  RVGGTFAKAIYRAYTDSSFNTLATTPAEWQHLGNVG-PVMYGAVGQVIRVVFKNNLDFPV 190

Query: 1207 SLHPHG 1224
            ++ P G
Sbjct: 191  NMAPSG 196

 Score = 36.6 bits (83), Expect(3) = 6e-25
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = +1

Query: 1936 HVMAGMRAKYTVTANASRMVVNPSGVTRTYYIQAEAVNWDYA 2061
            H+  GM A YTVT + + +     GV R YY++A+ V W Y+
Sbjct: 400  HMDGGMVALYTVTGDPAPLPTG--GVERVYYVRAQEVEWSYS 439

 Score = 32.3 bits (72), Expect(3) = 7e-21
 Identities = 25/63 (39%), Positives = 33/63 (51%)
 Frame = +1

Query: 1030 LGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPVMRANVGDTIKVVLKNDAKIDVS 1209
            +G  Y K +   YTDA+F+T  P     A  G  G P++ A VGD I V  KN A  D+ 
Sbjct: 846  IGSRYRKAVYRAYTDATFSTRVPTP---AYYGTMG-PMIIAEVGDRIVVHFKN-AVTDLE 900

Query: 1210 LHP 1218
             +P
Sbjct: 901  EYP 903

 Score = 23.9 bits (50), Expect(3) = 7e-21
 Identities = 9/15 (60%), Positives = 12/15 (80%)
 Frame = +1

Query: 1933 DHVMAGMRAKYTVTA 1977
            DH MAGM +++ VTA
Sbjct: 1127 DHYMAGMMSQFAVTA 1141

>gb|AAQ89349.1| HEPH [Homo sapiens]
          Length = 1160

 Score =  157 bits (398), Expect = 5e-37
 Identities = 98/296 (33%), Positives = 145/296 (48%), Gaps = 21/296 (7%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
            + KA++R YTD +F          +HLG +GP++ G VG ++ VVFKNN   P ++   G
Sbjct: 784  YKKAVFREYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHAHG 843

Query: 182  GLIAWDGNGRRSARIDPV--KPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSSVDPQKH 355
             L         S  + P+  +PG+ VTY W IPE +GP  N +     W+Y S+VDP K 
Sbjct: 844  VL--------ESTTVWPLAAEPGEVVTYQWNIPERSGPGPNDSACVS-WIYYSAVDPIKD 894

Query: 356  DNAGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPLL--------------- 490
              +GLVGP+ +      + +G   D+DR+   +F +  E  S  L               
Sbjct: 895  MYSGLVGPLAICQKGILEPHGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSI 954

Query: 491  -FQEDTSLTAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFHWHG 667
              Q++T L +   +   AING  + N+    +T+  GERV W++ ++G    LH  H+H 
Sbjct: 955  NLQDETFLESNKMH---AINGKLYANL--RGLTMYQGERVAWYMLAMGQDVDLHTIHFHA 1009

Query: 668  H-VVELNG--HHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTV 826
               +  NG  +  D     P     V MV   PGTW+ HCHV  H+  GM  L+TV
Sbjct: 1010 ESFLYRNGENYRADVVDLFPGTFEVVEMVASNPGTWLMHCHVTDHVHAGMETLFTV 1065

 Score =  150 bits (379), Expect(3) = 4e-66
 Identities = 104/319 (32%), Positives = 143/319 (44%), Gaps = 26/319 (8%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
            + K IY+ Y D S+      PA W  LG +GPV+   VG VI +  KN    P  + P G
Sbjct: 76   YKKTIYKEYKDDSYTDEVAQPA-W--LGFLGPVLQAEVGDVILIHLKNFATRPYTIHPHG 132

Query: 182  --------GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSS 337
                    G +  DG+       D V PG +  Y W IPE   P  +A      W+Y S 
Sbjct: 133  VFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPT-DADPACLTWIYHSH 191

Query: 338  VDPQKHDNAGLVGPIIVTSAANADANG--RARDVDRDVVAIFQLVQERASPLLFQEDTSL 511
            VD  +    GL+GP+I       D N   + +DVD D   +F +V E  S  L +   + 
Sbjct: 192  VDAPRDIATGLIGPLITCKRGALDGNSPPQRQDVDHDFFLLFSVVDENLSWHLNENIATY 251

Query: 512  ------------TAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNF 655
                        T   S    AING+ + N+P+  + +   +RV WH+  +G+   +H  
Sbjct: 252  CSDPASVDKEDETFQESNRMHAINGFVFGNLPE--LNMCAQKRVAWHLFGMGNEIDVHTA 309

Query: 656  HWHGHVVELNGHHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTV--- 826
             +HG ++   GHH D     P    +  MVP EPGTW+  C VN H   GM ALY V   
Sbjct: 310  FFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSC 369

Query: 827  -TGDPAPLPTGGVERVYYV 880
                P  L TG V R Y++
Sbjct: 370  SMAPPVDLLTGKV-RQYFI 387

 Score =  137 bits (344), Expect = 1e-30
 Identities = 96/319 (30%), Positives = 144/319 (45%), Gaps = 27/319 (8%)
 Frame = +2

Query: 8    KAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG-- 181
            K  Y A+ D +F        + +HLG +GPV+   VG  I+VVF N    P +M P G  
Sbjct: 433  KVRYEAFQDETFQEKMHLEED-RHLGILGPVIRAEVGDTIQVVFYNRASQPFSMQPHGVF 491

Query: 182  ------GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVAN--ATVTSRLWLYRSS 337
                  G +  DG+          KP + VTY W +P  AGP A   A +T   W+Y S+
Sbjct: 492  YEKDYEGTVYNDGSSYPGL---VAKPFEKVTYRWTVPPHAGPTAQDPACLT---WMYFSA 545

Query: 338  VDPQKHDNAGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPL---------- 487
             DP +  N+GLVGP++V  A    A+G+ + VD++   +F ++ E  S            
Sbjct: 546  ADPIRDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQAAAML 605

Query: 488  ---LFQEDTSLTAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFH 658
               L  ED       S    AING+ + N+P   + +  G+ V WH+  +G+   +H   
Sbjct: 606  DFRLLSEDIE-GFQDSNRMHAINGFLFSNLP--RLDMCKGDTVAWHLLGLGTETDVHGVM 662

Query: 659  WHGHVVELNGHHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTVTGDP 838
            + G+ V+L G         P       M PD  GT+  +C    H + GM A+Y V+  P
Sbjct: 663  FQGNTVQLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQAGSHREAGMRAIYNVSQCP 722

Query: 839  ----APLPTGGVERVYYVL 883
                 P       R+YY++
Sbjct: 723  GHQATPRQRYQAARIYYIM 741

 Score = 99.4 bits (246), Expect(4) = 9e-29
 Identities = 57/183 (31%), Positives = 92/183 (50%), Gaps = 1/183 (0%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            PG   TY WN+P+R+GPGP D + + W+Y+S +D   + Y+G+ G + +  K +      
Sbjct: 857  PGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPLAICQKGILEPHGG 916

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLA-NKLGDGGALAAQLAANATEMTALVTDPVF 1666
             +  D+DRE  + F + DE KS    EN+A +   D G++  Q             D  F
Sbjct: 917  RS--DMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQ-------------DETF 961

Query: 1667 MEHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMHTPNMGGPRF*LQRHAHRL 1846
            +E    H ING +Y ++  LT  QG++V  +++ +G   D+HT +     F L R+    
Sbjct: 962  LESNKMHAINGKLYANLRGLTMYQGERVAWYMLAMGQDVDLHTIHFHAESF-LYRNGENY 1020

Query: 1847 HPD 1855
              D
Sbjct: 1021 RAD 1023

 Score = 85.5 bits (210), Expect(4) = 3e-36
 Identities = 45/162 (27%), Positives = 75/162 (45%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            PG ++ Y W +P+   P   DP+ + W+YHSH+D   +   G+ G +I   +      + 
Sbjct: 160  PGGSHIYNWTIPEGHAPTDADPACLTWIYHSHVDAPRDIATGLIGPLITCKRGALDGNSP 219

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVFM 1669
               +DVD +  + F+VVDE  S +  EN+A    D  ++  +             D  F 
Sbjct: 220  PQRQDVDHDFFLLFSVVDENLSWHLNENIATYCSDPASVDKE-------------DETFQ 266

Query: 1670 EHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMHT 1795
            E    H ING ++ ++P L      +V  H+  +G   D+HT
Sbjct: 267  ESNRMHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHT 308

 Score = 85.1 bits (209), Expect(3) = 4e-66
 Identities = 54/161 (33%), Positives = 76/161 (46%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            P    TY W VP  AGP   DP+ + WMY S  D   +T +G+ G ++V         AD
Sbjct: 514  PFEKVTYRWTVPPHAGPTAQDPACLTWMYFSAADPIRDTNSGLVGPLLVCR--AGALGAD 571

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVFM 1669
               K VD+E  + FTV+DE KS     N A  + D   L+  +               F 
Sbjct: 572  GKQKGVDKEFFLLFTVLDENKSWYSNANQAAAMLDFRLLSEDIEG-------------FQ 618

Query: 1670 EHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMH 1792
            +    H ING ++ ++PRL   +GD V  H++ LGT  D+H
Sbjct: 619  DSNRMHAINGFLFSNLPRLDMCKGDTVAWHLLGLGTETDVH 659

 Score = 68.2 bits (165), Expect(4) = 3e-36
 Identities = 44/116 (37%), Positives = 63/116 (53%), Gaps = 2/116 (1%)
 Frame = +1

Query: 934  APLPELQFSSEPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTTVKPLAGGR 1113
            AP      +++P   ++  + FL+   +D  R+G  Y KT+  EY D S+T         
Sbjct: 43   APKGRNVITNQPLDSDIVASSFLK---SDKNRIGGTYKKTIYKEYKDDSYTDEV------ 93

Query: 1114 AVPGAAGV--PVMRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDGTS 1275
            A P   G   PV++A VGD I + LKN A    ++HPHGV Y K +EG+LY DG+S
Sbjct: 94   AQPAWLGFLGPVLQAEVGDVILIHLKNFATRPYTIHPHGVFYEKDSEGSLYPDGSS 149

 Score = 62.0 bits (149), Expect(3) = 4e-66
 Identities = 43/105 (40%), Positives = 56/105 (52%)
 Frame = +1

Query: 964  EPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPV 1143
            EPGS  ++   F +  S    R+G  Y K     + D +F     L   R + G  G PV
Sbjct: 411  EPGS--ISDKFFQKSSS----RIGGTYWKVRYEAFQDETFQEKMHLEEDRHL-GILG-PV 462

Query: 1144 MRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDGTSW 1278
            +RA VGDTI+VV  N A    S+ PHGV Y K  EGT+Y DG+S+
Sbjct: 463  IRAEVGDTIQVVFYNRASQPFSMQPHGVFYEKDYEGTVYNDGSSY 507

 Score = 50.4 bits (119), Expect(4) = 9e-29
 Identities = 27/66 (40%), Positives = 36/66 (53%)
 Frame = +1

Query: 1030 LGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPVMRANVGDTIKVVLKNDAKIDVS 1209
            LG  Y K +  EYTD +F   +P  G     G  G P+++  VGD + VV KN+A    S
Sbjct: 780  LGSRYKKAVFREYTDGTFRIPRPRTGPEEHLGILG-PLIKGEVGDILTVVFKNNASRPYS 838

Query: 1210 LHPHGV 1227
            +H HGV
Sbjct: 839  VHAHGV 844

 Score = 35.0 bits (79), Expect(4) = 3e-36
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +1

Query: 1936 HVMAGMRAKYTVTANASRMVVNP-SGVTRTYYIQAEAVNWDYAPAGY 2073
            H   GM+A Y V + +    V+  +G  R Y+I+A  + WDY P G+
Sbjct: 355  HFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGH 401

 Score = 34.3 bits (77), Expect = 8.9
 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%)
 Frame = +1

Query: 1936 HVMAGMRAKYTVTANASRMVVNPSG--VTRTYYIQAEAVNWDYAP 2064
            H  AGMRA Y V+                R YYI AE V WDY P
Sbjct: 707  HREAGMRAIYNVSQCPGHQATPRQRYQAARIYYIMAEEVEWDYCP 751

 Score = 28.1 bits (61), Expect(4) = 3e-36
 Identities = 16/43 (37%), Positives = 22/43 (50%), Gaps = 1/43 (2%)
 Frame = +3

Query: 1830 GMHTDSIQISPGGMVSADVQMTSPGDYELQCRVCGP-RDGGHA 1955
            G HTD   I P   V+A++    PG + + C+V    RDG  A
Sbjct: 320  GHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQA 362

 Score = 20.8 bits (42), Expect(4) = 9e-29
 Identities = 8/20 (40%), Positives = 11/20 (55%)
 Frame = +1

Query: 1933 DHVMAGMRAKYTVTANASRM 1992
            DHV AGM   +TV +    +
Sbjct: 1053 DHVHAGMETLFTVFSRTEHL 1072

 Score = 20.8 bits (42), Expect(4) = 9e-29
 Identities = 7/29 (24%), Positives = 15/29 (51%)
 Frame = +3

Query: 1842 DSIQISPGGMVSADVQMTSPGDYELQCRV 1928
            D + + PG     ++  ++PG + + C V
Sbjct: 1023 DVVDLFPGTFEVVEMVASNPGTWLMHCHV 1051

>ref|NP_620074.1| hephaestin isoform a [Homo sapiens]
            gi|12830539|gb|AAK08131.1|AF148860_1 hephaestin [Homo
            sapiens] gi|15079445|gb|AAH11561.1| Hephaestin, isoform a
            [Homo sapiens]
          Length = 1158

 Score =  157 bits (398), Expect = 5e-37
 Identities = 98/296 (33%), Positives = 145/296 (48%), Gaps = 21/296 (7%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
            + KA++R YTD +F          +HLG +GP++ G VG ++ VVFKNN   P ++   G
Sbjct: 781  YKKAVFREYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHAHG 840

Query: 182  GLIAWDGNGRRSARIDPV--KPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSSVDPQKH 355
             L         S  + P+  +PG+ VTY W IPE +GP  N +     W+Y S+VDP K 
Sbjct: 841  VL--------ESTTVWPLAAEPGEVVTYQWNIPERSGPGPNDSACVS-WIYYSAVDPIKD 891

Query: 356  DNAGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPLL--------------- 490
              +GLVGP+ +      + +G   D+DR+   +F +  E  S  L               
Sbjct: 892  MYSGLVGPLAICQKGILEPHGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSI 951

Query: 491  -FQEDTSLTAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFHWHG 667
              Q++T L +   +   AING  + N+    +T+  GERV W++ ++G    LH  H+H 
Sbjct: 952  NLQDETFLESNKMH---AINGKLYANL--RGLTMYQGERVAWYMLAMGQDVDLHTIHFHA 1006

Query: 668  H-VVELNG--HHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTV 826
               +  NG  +  D     P     V MV   PGTW+ HCHV  H+  GM  L+TV
Sbjct: 1007 ESFLYRNGENYRADVVDLFPGTFEVVEMVASNPGTWLMHCHVTDHVHAGMETLFTV 1062

 Score =  150 bits (379), Expect(3) = 4e-66
 Identities = 104/319 (32%), Positives = 143/319 (44%), Gaps = 26/319 (8%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
            + K IY+ Y D S+      PA W  LG +GPV+   VG VI +  KN    P  + P G
Sbjct: 73   YKKTIYKEYKDDSYTDEVAQPA-W--LGFLGPVLQAEVGDVILIHLKNFATRPYTIHPHG 129

Query: 182  --------GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSS 337
                    G +  DG+       D V PG +  Y W IPE   P  +A      W+Y S 
Sbjct: 130  VFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPT-DADPACLTWIYHSH 188

Query: 338  VDPQKHDNAGLVGPIIVTSAANADANG--RARDVDRDVVAIFQLVQERASPLLFQEDTSL 511
            VD  +    GL+GP+I       D N   + +DVD D   +F +V E  S  L +   + 
Sbjct: 189  VDAPRDIATGLIGPLITCKRGALDGNSPPQRQDVDHDFFLLFSVVDENLSWHLNENIATY 248

Query: 512  ------------TAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNF 655
                        T   S    AING+ + N+P+  + +   +RV WH+  +G+   +H  
Sbjct: 249  CSDPASVDKEDETFQESNRMHAINGFVFGNLPE--LNMCAQKRVAWHLFGMGNEIDVHTA 306

Query: 656  HWHGHVVELNGHHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTV--- 826
             +HG ++   GHH D     P    +  MVP EPGTW+  C VN H   GM ALY V   
Sbjct: 307  FFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSC 366

Query: 827  -TGDPAPLPTGGVERVYYV 880
                P  L TG V R Y++
Sbjct: 367  SMAPPVDLLTGKV-RQYFI 384

 Score =  137 bits (344), Expect = 1e-30
 Identities = 96/319 (30%), Positives = 144/319 (45%), Gaps = 27/319 (8%)
 Frame = +2

Query: 8    KAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG-- 181
            K  Y A+ D +F        + +HLG +GPV+   VG  I+VVF N    P +M P G  
Sbjct: 430  KVRYEAFQDETFQEKMHLEED-RHLGILGPVIRAEVGDTIQVVFYNRASQPFSMQPHGVF 488

Query: 182  ------GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVAN--ATVTSRLWLYRSS 337
                  G +  DG+          KP + VTY W +P  AGP A   A +T   W+Y S+
Sbjct: 489  YEKDYEGTVYNDGSSYPGL---VAKPFEKVTYRWTVPPHAGPTAQDPACLT---WMYFSA 542

Query: 338  VDPQKHDNAGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPL---------- 487
             DP +  N+GLVGP++V  A    A+G+ + VD++   +F ++ E  S            
Sbjct: 543  ADPIRDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQAAAML 602

Query: 488  ---LFQEDTSLTAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFH 658
               L  ED       S    AING+ + N+P   + +  G+ V WH+  +G+   +H   
Sbjct: 603  DFRLLSEDIE-GFQDSNRMHAINGFLFSNLP--RLDMCKGDTVAWHLLGLGTETDVHGVM 659

Query: 659  WHGHVVELNGHHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTVTGDP 838
            + G+ V+L G         P       M PD  GT+  +C    H + GM A+Y V+  P
Sbjct: 660  FQGNTVQLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQAGSHREAGMRAIYNVSQCP 719

Query: 839  ----APLPTGGVERVYYVL 883
                 P       R+YY++
Sbjct: 720  GHQATPRQRYQAARIYYIM 738

 Score = 99.4 bits (246), Expect(4) = 9e-29
 Identities = 57/183 (31%), Positives = 92/183 (50%), Gaps = 1/183 (0%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            PG   TY WN+P+R+GPGP D + + W+Y+S +D   + Y+G+ G + +  K +      
Sbjct: 854  PGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPLAICQKGILEPHGG 913

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLA-NKLGDGGALAAQLAANATEMTALVTDPVF 1666
             +  D+DRE  + F + DE KS    EN+A +   D G++  Q             D  F
Sbjct: 914  RS--DMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQ-------------DETF 958

Query: 1667 MEHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMHTPNMGGPRF*LQRHAHRL 1846
            +E    H ING +Y ++  LT  QG++V  +++ +G   D+HT +     F L R+    
Sbjct: 959  LESNKMHAINGKLYANLRGLTMYQGERVAWYMLAMGQDVDLHTIHFHAESF-LYRNGENY 1017

Query: 1847 HPD 1855
              D
Sbjct: 1018 RAD 1020

 Score = 85.5 bits (210), Expect(4) = 3e-36
 Identities = 45/162 (27%), Positives = 75/162 (45%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            PG ++ Y W +P+   P   DP+ + W+YHSH+D   +   G+ G +I   +      + 
Sbjct: 157  PGGSHIYNWTIPEGHAPTDADPACLTWIYHSHVDAPRDIATGLIGPLITCKRGALDGNSP 216

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVFM 1669
               +DVD +  + F+VVDE  S +  EN+A    D  ++  +             D  F 
Sbjct: 217  PQRQDVDHDFFLLFSVVDENLSWHLNENIATYCSDPASVDKE-------------DETFQ 263

Query: 1670 EHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMHT 1795
            E    H ING ++ ++P L      +V  H+  +G   D+HT
Sbjct: 264  ESNRMHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHT 305

 Score = 85.1 bits (209), Expect(3) = 4e-66
 Identities = 54/161 (33%), Positives = 76/161 (46%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            P    TY W VP  AGP   DP+ + WMY S  D   +T +G+ G ++V         AD
Sbjct: 511  PFEKVTYRWTVPPHAGPTAQDPACLTWMYFSAADPIRDTNSGLVGPLLVCR--AGALGAD 568

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVFM 1669
               K VD+E  + FTV+DE KS     N A  + D   L+  +               F 
Sbjct: 569  GKQKGVDKEFFLLFTVLDENKSWYSNANQAAAMLDFRLLSEDIEG-------------FQ 615

Query: 1670 EHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMH 1792
            +    H ING ++ ++PRL   +GD V  H++ LGT  D+H
Sbjct: 616  DSNRMHAINGFLFSNLPRLDMCKGDTVAWHLLGLGTETDVH 656

 Score = 68.2 bits (165), Expect(4) = 3e-36
 Identities = 44/116 (37%), Positives = 63/116 (53%), Gaps = 2/116 (1%)
 Frame = +1

Query: 934  APLPELQFSSEPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTTVKPLAGGR 1113
            AP      +++P   ++  + FL+   +D  R+G  Y KT+  EY D S+T         
Sbjct: 40   APKGRNVITNQPLDSDIVASSFLK---SDKNRIGGTYKKTIYKEYKDDSYTDEV------ 90

Query: 1114 AVPGAAGV--PVMRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDGTS 1275
            A P   G   PV++A VGD I + LKN A    ++HPHGV Y K +EG+LY DG+S
Sbjct: 91   AQPAWLGFLGPVLQAEVGDVILIHLKNFATRPYTIHPHGVFYEKDSEGSLYPDGSS 146

 Score = 62.0 bits (149), Expect(3) = 4e-66
 Identities = 43/105 (40%), Positives = 56/105 (52%)
 Frame = +1

Query: 964  EPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPV 1143
            EPGS  ++   F +  S    R+G  Y K     + D +F     L   R + G  G PV
Sbjct: 408  EPGS--ISDKFFQKSSS----RIGGTYWKVRYEAFQDETFQEKMHLEEDRHL-GILG-PV 459

Query: 1144 MRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDGTSW 1278
            +RA VGDTI+VV  N A    S+ PHGV Y K  EGT+Y DG+S+
Sbjct: 460  IRAEVGDTIQVVFYNRASQPFSMQPHGVFYEKDYEGTVYNDGSSY 504

 Score = 50.4 bits (119), Expect(4) = 9e-29
 Identities = 27/66 (40%), Positives = 36/66 (53%)
 Frame = +1

Query: 1030 LGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPVMRANVGDTIKVVLKNDAKIDVS 1209
            LG  Y K +  EYTD +F   +P  G     G  G P+++  VGD + VV KN+A    S
Sbjct: 777  LGSRYKKAVFREYTDGTFRIPRPRTGPEEHLGILG-PLIKGEVGDILTVVFKNNASRPYS 835

Query: 1210 LHPHGV 1227
            +H HGV
Sbjct: 836  VHAHGV 841

 Score = 35.0 bits (79), Expect(4) = 3e-36
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +1

Query: 1936 HVMAGMRAKYTVTANASRMVVNP-SGVTRTYYIQAEAVNWDYAPAGY 2073
            H   GM+A Y V + +    V+  +G  R Y+I+A  + WDY P G+
Sbjct: 352  HFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGH 398

 Score = 34.3 bits (77), Expect = 8.9
 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%)
 Frame = +1

Query: 1936 HVMAGMRAKYTVTANASRMVVNPSG--VTRTYYIQAEAVNWDYAP 2064
            H  AGMRA Y V+                R YYI AE V WDY P
Sbjct: 704  HREAGMRAIYNVSQCPGHQATPRQRYQAARIYYIMAEEVEWDYCP 748

 Score = 28.1 bits (61), Expect(4) = 3e-36
 Identities = 16/43 (37%), Positives = 22/43 (50%), Gaps = 1/43 (2%)
 Frame = +3

Query: 1830 GMHTDSIQISPGGMVSADVQMTSPGDYELQCRVCGP-RDGGHA 1955
            G HTD   I P   V+A++    PG + + C+V    RDG  A
Sbjct: 317  GHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQA 359

 Score = 20.8 bits (42), Expect(4) = 9e-29
 Identities = 8/20 (40%), Positives = 11/20 (55%)
 Frame = +1

Query: 1933 DHVMAGMRAKYTVTANASRM 1992
            DHV AGM   +TV +    +
Sbjct: 1050 DHVHAGMETLFTVFSRTEHL 1069

 Score = 20.8 bits (42), Expect(4) = 9e-29
 Identities = 7/29 (24%), Positives = 15/29 (51%)
 Frame = +3

Query: 1842 DSIQISPGGMVSADVQMTSPGDYELQCRV 1928
            D + + PG     ++  ++PG + + C V
Sbjct: 1020 DVVDLFPGTFEVVEMVASNPGTWLMHCHV 1048

>dbj|BAA31673.2| KIAA0698 protein [Homo sapiens]
          Length = 1104

 Score =  157 bits (398), Expect = 5e-37
 Identities = 98/296 (33%), Positives = 145/296 (48%), Gaps = 21/296 (7%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
            + KA++R YTD +F          +HLG +GP++ G VG ++ VVFKNN   P ++   G
Sbjct: 727  YKKAVFREYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHAHG 786

Query: 182  GLIAWDGNGRRSARIDPV--KPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSSVDPQKH 355
             L         S  + P+  +PG+ VTY W IPE +GP  N +     W+Y S+VDP K 
Sbjct: 787  VL--------ESTTVWPLAAEPGEVVTYQWNIPERSGPGPNDSACVS-WIYYSAVDPIKD 837

Query: 356  DNAGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPLL--------------- 490
              +GLVGP+ +      + +G   D+DR+   +F +  E  S  L               
Sbjct: 838  MYSGLVGPLAICQKGILEPHGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSI 897

Query: 491  -FQEDTSLTAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFHWHG 667
              Q++T L +   +   AING  + N+    +T+  GERV W++ ++G    LH  H+H 
Sbjct: 898  NLQDETFLESNKMH---AINGKLYANL--RGLTMYQGERVAWYMLAMGQDVDLHTIHFHA 952

Query: 668  H-VVELNG--HHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTV 826
               +  NG  +  D     P     V MV   PGTW+ HCHV  H+  GM  L+TV
Sbjct: 953  ESFLYRNGENYRADVVDLFPGTFEVVEMVASNPGTWLMHCHVTDHVHAGMETLFTV 1008

 Score =  150 bits (379), Expect(3) = 4e-66
 Identities = 104/319 (32%), Positives = 143/319 (44%), Gaps = 26/319 (8%)
 Frame = +2

Query: 2   FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
           + K IY+ Y D S+      PA W  LG +GPV+   VG VI +  KN    P  + P G
Sbjct: 19  YKKTIYKEYKDDSYTDEVAQPA-W--LGFLGPVLQAEVGDVILIHLKNFATRPYTIHPHG 75

Query: 182 --------GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSS 337
                   G +  DG+       D V PG +  Y W IPE   P  +A      W+Y S 
Sbjct: 76  VFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPT-DADPACLTWIYHSH 134

Query: 338 VDPQKHDNAGLVGPIIVTSAANADANG--RARDVDRDVVAIFQLVQERASPLLFQEDTSL 511
           VD  +    GL+GP+I       D N   + +DVD D   +F +V E  S  L +   + 
Sbjct: 135 VDAPRDIATGLIGPLITCKRGALDGNSPPQRQDVDHDFFLLFSVVDENLSWHLNENIATY 194

Query: 512 ------------TAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNF 655
                       T   S    AING+ + N+P+  + +   +RV WH+  +G+   +H  
Sbjct: 195 CSDPASVDKEDETFQESNRMHAINGFVFGNLPE--LNMCAQKRVAWHLFGMGNEIDVHTA 252

Query: 656 HWHGHVVELNGHHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTV--- 826
            +HG ++   GHH D     P    +  MVP EPGTW+  C VN H   GM ALY V   
Sbjct: 253 FFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSC 312

Query: 827 -TGDPAPLPTGGVERVYYV 880
               P  L TG V R Y++
Sbjct: 313 SMAPPVDLLTGKV-RQYFI 330

 Score =  137 bits (344), Expect = 1e-30
 Identities = 96/319 (30%), Positives = 144/319 (45%), Gaps = 27/319 (8%)
 Frame = +2

Query: 8    KAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG-- 181
            K  Y A+ D +F        + +HLG +GPV+   VG  I+VVF N    P +M P G  
Sbjct: 376  KVRYEAFQDETFQEKMHLEED-RHLGILGPVIRAEVGDTIQVVFYNRASQPFSMQPHGVF 434

Query: 182  ------GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVAN--ATVTSRLWLYRSS 337
                  G +  DG+          KP + VTY W +P  AGP A   A +T   W+Y S+
Sbjct: 435  YEKDYEGTVYNDGSSYPGL---VAKPFEKVTYRWTVPPHAGPTAQDPACLT---WMYFSA 488

Query: 338  VDPQKHDNAGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPL---------- 487
             DP +  N+GLVGP++V  A    A+G+ + VD++   +F ++ E  S            
Sbjct: 489  ADPIRDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQAAAML 548

Query: 488  ---LFQEDTSLTAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFH 658
               L  ED       S    AING+ + N+P   + +  G+ V WH+  +G+   +H   
Sbjct: 549  DFRLLSEDIE-GFQDSNRMHAINGFLFSNLP--RLDMCKGDTVAWHLLGLGTETDVHGVM 605

Query: 659  WHGHVVELNGHHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTVTGDP 838
            + G+ V+L G         P       M PD  GT+  +C    H + GM A+Y V+  P
Sbjct: 606  FQGNTVQLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQAGSHREAGMRAIYNVSQCP 665

Query: 839  ----APLPTGGVERVYYVL 883
                 P       R+YY++
Sbjct: 666  GHQATPRQRYQAARIYYIM 684

 Score = 99.4 bits (246), Expect(4) = 9e-29
 Identities = 57/183 (31%), Positives = 92/183 (50%), Gaps = 1/183 (0%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            PG   TY WN+P+R+GPGP D + + W+Y+S +D   + Y+G+ G + +  K +      
Sbjct: 800  PGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPLAICQKGILEPHGG 859

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLA-NKLGDGGALAAQLAANATEMTALVTDPVF 1666
             +  D+DRE  + F + DE KS    EN+A +   D G++  Q             D  F
Sbjct: 860  RS--DMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQ-------------DETF 904

Query: 1667 MEHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMHTPNMGGPRF*LQRHAHRL 1846
            +E    H ING +Y ++  LT  QG++V  +++ +G   D+HT +     F L R+    
Sbjct: 905  LESNKMHAINGKLYANLRGLTMYQGERVAWYMLAMGQDVDLHTIHFHAESF-LYRNGENY 963

Query: 1847 HPD 1855
              D
Sbjct: 964  RAD 966

 Score = 85.5 bits (210), Expect(4) = 2e-35
 Identities = 45/162 (27%), Positives = 75/162 (45%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            PG ++ Y W +P+   P   DP+ + W+YHSH+D   +   G+ G +I   +      + 
Sbjct: 103  PGGSHIYNWTIPEGHAPTDADPACLTWIYHSHVDAPRDIATGLIGPLITCKRGALDGNSP 162

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVFM 1669
               +DVD +  + F+VVDE  S +  EN+A    D  ++  +             D  F 
Sbjct: 163  PQRQDVDHDFFLLFSVVDENLSWHLNENIATYCSDPASVDKE-------------DETFQ 209

Query: 1670 EHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMHT 1795
            E    H ING ++ ++P L      +V  H+  +G   D+HT
Sbjct: 210  ESNRMHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHT 251

 Score = 85.1 bits (209), Expect(3) = 4e-66
 Identities = 54/161 (33%), Positives = 76/161 (46%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            P    TY W VP  AGP   DP+ + WMY S  D   +T +G+ G ++V         AD
Sbjct: 457  PFEKVTYRWTVPPHAGPTAQDPACLTWMYFSAADPIRDTNSGLVGPLLVCR--AGALGAD 514

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVFM 1669
               K VD+E  + FTV+DE KS     N A  + D   L+  +               F 
Sbjct: 515  GKQKGVDKEFFLLFTVLDENKSWYSNANQAAAMLDFRLLSEDIEG-------------FQ 561

Query: 1670 EHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMH 1792
            +    H ING ++ ++PRL   +GD V  H++ LGT  D+H
Sbjct: 562  DSNRMHAINGFLFSNLPRLDMCKGDTVAWHLLGLGTETDVH 602

 Score = 65.5 bits (158), Expect(4) = 2e-35
 Identities = 39/89 (43%), Positives = 51/89 (56%), Gaps = 2/89 (2%)
 Frame = +1

Query: 1015 TDPVRLGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGV--PVMRANVGDTIKVVLKN 1188
            +D  R+G  Y KT+  EY D S+T         A P   G   PV++A VGD I + LKN
Sbjct: 10   SDKNRIGGTYKKTIYKEYKDDSYTDEV------AQPAWLGFLGPVLQAEVGDVILIHLKN 63

Query: 1189 DAKIDVSLHPHGVRYSKANEGTLYEDGTS 1275
             A    ++HPHGV Y K +EG+LY DG+S
Sbjct: 64   FATRPYTIHPHGVFYEKDSEGSLYPDGSS 92

 Score = 62.0 bits (149), Expect(3) = 4e-66
 Identities = 43/105 (40%), Positives = 56/105 (52%)
 Frame = +1

Query: 964  EPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPV 1143
            EPGS  ++   F +  S    R+G  Y K     + D +F     L   R + G  G PV
Sbjct: 354  EPGS--ISDKFFQKSSS----RIGGTYWKVRYEAFQDETFQEKMHLEEDRHL-GILG-PV 405

Query: 1144 MRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDGTSW 1278
            +RA VGDTI+VV  N A    S+ PHGV Y K  EGT+Y DG+S+
Sbjct: 406  IRAEVGDTIQVVFYNRASQPFSMQPHGVFYEKDYEGTVYNDGSSY 450

 Score = 50.4 bits (119), Expect(4) = 9e-29
 Identities = 27/66 (40%), Positives = 36/66 (53%)
 Frame = +1

Query: 1030 LGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPVMRANVGDTIKVVLKNDAKIDVS 1209
            LG  Y K +  EYTD +F   +P  G     G  G P+++  VGD + VV KN+A    S
Sbjct: 723  LGSRYKKAVFREYTDGTFRIPRPRTGPEEHLGILG-PLIKGEVGDILTVVFKNNASRPYS 781

Query: 1210 LHPHGV 1227
            +H HGV
Sbjct: 782  VHAHGV 787

 Score = 35.0 bits (79), Expect(4) = 2e-35
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +1

Query: 1936 HVMAGMRAKYTVTANASRMVVNP-SGVTRTYYIQAEAVNWDYAPAGY 2073
            H   GM+A Y V + +    V+  +G  R Y+I+A  + WDY P G+
Sbjct: 298  HFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGH 344

 Score = 34.3 bits (77), Expect = 8.9
 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%)
 Frame = +1

Query: 1936 HVMAGMRAKYTVTANASRMVVNPSG--VTRTYYIQAEAVNWDYAP 2064
            H  AGMRA Y V+                R YYI AE V WDY P
Sbjct: 650  HREAGMRAIYNVSQCPGHQATPRQRYQAARIYYIMAEEVEWDYCP 694

 Score = 28.1 bits (61), Expect(4) = 2e-35
 Identities = 16/43 (37%), Positives = 22/43 (50%), Gaps = 1/43 (2%)
 Frame = +3

Query: 1830 GMHTDSIQISPGGMVSADVQMTSPGDYELQCRVCGP-RDGGHA 1955
            G HTD   I P   V+A++    PG + + C+V    RDG  A
Sbjct: 263  GHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQA 305

 Score = 20.8 bits (42), Expect(4) = 9e-29
 Identities = 8/20 (40%), Positives = 11/20 (55%)
 Frame = +1

Query: 1933 DHVMAGMRAKYTVTANASRM 1992
            DHV AGM   +TV +    +
Sbjct: 996  DHVHAGMETLFTVFSRTEHL 1015

 Score = 20.8 bits (42), Expect(4) = 9e-29
 Identities = 7/29 (24%), Positives = 15/29 (51%)
 Frame = +3

Query: 1842 DSIQISPGGMVSADVQMTSPGDYELQCRV 1928
            D + + PG     ++  ++PG + + C V
Sbjct: 966  DVVDLFPGTFEVVEMVASNPGTWLMHCHV 994

>emb|CAC35365.2| hephaestin [Homo sapiens]
          Length = 1158

 Score =  157 bits (398), Expect = 5e-37
 Identities = 98/296 (33%), Positives = 145/296 (48%), Gaps = 21/296 (7%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
            + KA++R YTD +F          +HLG +GP++ G VG ++ VVFKNN   P ++   G
Sbjct: 781  YKKAVFREYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHAHG 840

Query: 182  GLIAWDGNGRRSARIDPV--KPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSSVDPQKH 355
             L         S  + P+  +PG+ VTY W IPE +GP  N +     W+Y S+VDP K 
Sbjct: 841  VL--------ESTTVWPLAAEPGEVVTYQWNIPERSGPGPNDSACVS-WIYYSAVDPIKD 891

Query: 356  DNAGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPLL--------------- 490
              +GLVGP+ +      + +G   D+DR+   +F +  E  S  L               
Sbjct: 892  MYSGLVGPLAICQKGILEPHGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSI 951

Query: 491  -FQEDTSLTAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFHWHG 667
              Q++T L +   +   AING  + N+    +T+  GERV W++ ++G    LH  H+H 
Sbjct: 952  NLQDETFLESNKMH---AINGKLYANL--RGLTMYQGERVAWYMLAMGQDVDLHTIHFHA 1006

Query: 668  H-VVELNG--HHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTV 826
               +  NG  +  D     P     V MV   PGTW+ HCHV  H+  GM  L+TV
Sbjct: 1007 ESFLYRNGENYRADVVDLFPGTFEVVEMVASNPGTWLMHCHVTDHVHAGMETLFTV 1062

 Score =  149 bits (375), Expect(3) = 1e-65
 Identities = 103/319 (32%), Positives = 142/319 (44%), Gaps = 26/319 (8%)
 Frame = +2

Query: 2    FAKAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG 181
            + K IY+ Y D S+      PA W  LG +GPV+   VG VI +  KN    P  + P G
Sbjct: 73   YKKTIYKEYKDDSYTDEVAQPA-W--LGFLGPVLQAEVGDVILIHLKNFATRPYTIHPHG 129

Query: 182  --------GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVANATVTSRLWLYRSS 337
                    G +  DG+       D V PG +  Y W IPE   P  +A      W+Y S 
Sbjct: 130  VFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPT-DADPACLTWIYHSH 188

Query: 338  VDPQKHDNAGLVGPIIVTSAANADANG--RARDVDRDVVAIFQLVQERASPLLFQEDTSL 511
            VD  +    GL+GP+I       D N   + +D D D   +F +V E  S  L +   + 
Sbjct: 189  VDAPRDIATGLIGPLITCKRGALDGNSPPQRQDTDHDFFLLFSVVDENLSWHLNENIATY 248

Query: 512  ------------TAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNF 655
                        T   S    AING+ + N+P+  + +   +RV WH+  +G+   +H  
Sbjct: 249  CSDPASVDKEDETFQESNRMHAINGFVFGNLPE--LNMCAQKRVAWHLFGMGNEIDVHTA 306

Query: 656  HWHGHVVELNGHHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTV--- 826
             +HG ++   GHH D     P    +  MVP EPGTW+  C VN H   GM ALY V   
Sbjct: 307  FFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSC 366

Query: 827  -TGDPAPLPTGGVERVYYV 880
                P  L TG V R Y++
Sbjct: 367  SMAPPVDLLTGKV-RQYFI 384

 Score =  137 bits (344), Expect = 1e-30
 Identities = 96/319 (30%), Positives = 144/319 (45%), Gaps = 27/319 (8%)
 Frame = +2

Query: 8    KAIYRAYTDSSFNTLATTPAEWQHLGNVGPVMYGAVGQVIRVVFKNNLDFPVNMAPSG-- 181
            K  Y A+ D +F        + +HLG +GPV+   VG  I+VVF N    P +M P G  
Sbjct: 430  KVRYEAFQDETFQEKMHLEED-RHLGILGPVIRAEVGDTIQVVFYNRASQPFSMQPHGVF 488

Query: 182  ------GLIAWDGNGRRSARIDPVKPGQTVTYLWQIPEDAGPVAN--ATVTSRLWLYRSS 337
                  G +  DG+          KP + VTY W +P  AGP A   A +T   W+Y S+
Sbjct: 489  YEKDYEGTVYNDGSSYPGL---VAKPFEKVTYRWTVPPHAGPTAQDPACLT---WMYFSA 542

Query: 338  VDPQKHDNAGLVGPIIVTSAANADANGRARDVDRDVVAIFQLVQERASPL---------- 487
             DP +  N+GLVGP++V  A    A+G+ + VD++   +F ++ E  S            
Sbjct: 543  ADPIRDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQAAAML 602

Query: 488  ---LFQEDTSLTAGTSYTKMAINGYTWCNMPDGAITIKTGERVRWHVASIGSSESLHNFH 658
               L  ED       S    AING+ + N+P   + +  G+ V WH+  +G+   +H   
Sbjct: 603  DFRLLSEDIE-GFQDSNRMHAINGFLFSNLP--RLDMCKGDTVAWHLLGLGTETDVHGVM 659

Query: 659  WHGHVVELNGHHVDQFTAIPTATYSVNMVPDEPGTWMFHCHVNFHMDGGMVALYTVTGDP 838
            + G+ V+L G         P       M PD  GT+  +C    H + GM A+Y V+  P
Sbjct: 660  FQGNTVQLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQAGSHREAGMRAIYNVSQCP 719

Query: 839  ----APLPTGGVERVYYVL 883
                 P       R+YY++
Sbjct: 720  GHQATPRQRYQAARIYYIM 738

 Score = 99.4 bits (246), Expect(4) = 9e-29
 Identities = 57/183 (31%), Positives = 92/183 (50%), Gaps = 1/183 (0%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            PG   TY WN+P+R+GPGP D + + W+Y+S +D   + Y+G+ G + +  K +      
Sbjct: 854  PGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPLAICQKGILEPHGG 913

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLA-NKLGDGGALAAQLAANATEMTALVTDPVF 1666
             +  D+DRE  + F + DE KS    EN+A +   D G++  Q             D  F
Sbjct: 914  RS--DMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQ-------------DETF 958

Query: 1667 MEHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMHTPNMGGPRF*LQRHAHRL 1846
            +E    H ING +Y ++  LT  QG++V  +++ +G   D+HT +     F L R+    
Sbjct: 959  LESNKMHAINGKLYANLRGLTMYQGERVAWYMLAMGQDVDLHTIHFHAESF-LYRNGENY 1017

Query: 1847 HPD 1855
              D
Sbjct: 1018 RAD 1020

 Score = 85.1 bits (209), Expect(3) = 1e-65
 Identities = 54/161 (33%), Positives = 76/161 (46%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            P    TY W VP  AGP   DP+ + WMY S  D   +T +G+ G ++V         AD
Sbjct: 511  PFEKVTYRWTVPPHAGPTAQDPACLTWMYFSAADPIRDTNSGLVGPLLVCR--AGALGAD 568

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVFM 1669
               K VD+E  + FTV+DE KS     N A  + D   L+  +               F 
Sbjct: 569  GKQKGVDKEFFLLFTVLDENKSWYSNANQAAAMLDFRLLSEDIEG-------------FQ 615

Query: 1670 EHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMH 1792
            +    H ING ++ ++PRL   +GD V  H++ LGT  D+H
Sbjct: 616  DSNRMHAINGFLFSNLPRLDMCKGDTVAWHLLGLGTETDVH 656

 Score = 84.0 bits (206), Expect(4) = 1e-35
 Identities = 44/162 (27%), Positives = 74/162 (45%)
 Frame = +2

Query: 1310 PGTTYTYVWNVPDRAGPGPCDPSSMLWMYHSHIDETAETYAGVAGGIIVTAKDMARSTAD 1489
            PG ++ Y W +P+   P   DP+ + W+YHSH+D   +   G+ G +I   +      + 
Sbjct: 157  PGGSHIYNWTIPEGHAPTDADPACLTWIYHSHVDAPRDIATGLIGPLITCKRGALDGNSP 216

Query: 1490 LTPKDVDREIVIFFTVVDEIKSSNFMENLANKLGDGGALAAQLAANATEMTALVTDPVFM 1669
               +D D +  + F+VVDE  S +  EN+A    D  ++  +             D  F 
Sbjct: 217  PQRQDTDHDFFLLFSVVDENLSWHLNENIATYCSDPASVDKE-------------DETFQ 263

Query: 1670 EHMLKHGINGHMYCHMPRLTFEQGDKVRLHVMVLGTLEDMHT 1795
            E    H ING ++ ++P L      +V  H+  +G   D+HT
Sbjct: 264  ESNRMHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHT 305

 Score = 68.2 bits (165), Expect(4) = 1e-35
 Identities = 44/116 (37%), Positives = 63/116 (53%), Gaps = 2/116 (1%)
 Frame = +1

Query: 934  APLPELQFSSEPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTTVKPLAGGR 1113
            AP      +++P   ++  + FL+   +D  R+G  Y KT+  EY D S+T         
Sbjct: 40   APKGRNVITNQPLDSDIVASSFLK---SDKNRIGGTYKKTIYKEYKDDSYTDEV------ 90

Query: 1114 AVPGAAGV--PVMRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDGTS 1275
            A P   G   PV++A VGD I + LKN A    ++HPHGV Y K +EG+LY DG+S
Sbjct: 91   AQPAWLGFLGPVLQAEVGDVILIHLKNFATRPYTIHPHGVFYEKDSEGSLYPDGSS 146

 Score = 62.0 bits (149), Expect(3) = 1e-65
 Identities = 43/105 (40%), Positives = 56/105 (52%)
 Frame = +1

Query: 964  EPGSEEVNGNVFLEGPSTDPVRLGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPV 1143
            EPGS  ++   F +  S    R+G  Y K     + D +F     L   R + G  G PV
Sbjct: 408  EPGS--ISDKFFQKSSS----RIGGTYWKVRYEAFQDETFQEKMHLEEDRHL-GILG-PV 459

Query: 1144 MRANVGDTIKVVLKNDAKIDVSLHPHGVRYSKANEGTLYEDGTSW 1278
            +RA VGDTI+VV  N A    S+ PHGV Y K  EGT+Y DG+S+
Sbjct: 460  IRAEVGDTIQVVFYNRASQPFSMQPHGVFYEKDYEGTVYNDGSSY 504

 Score = 50.4 bits (119), Expect(4) = 9e-29
 Identities = 27/66 (40%), Positives = 36/66 (53%)
 Frame = +1

Query: 1030 LGHIYTKTLLIEYTDASFTTVKPLAGGRAVPGAAGVPVMRANVGDTIKVVLKNDAKIDVS 1209
            LG  Y K +  EYTD +F   +P  G     G  G P+++  VGD + VV KN+A    S
Sbjct: 777  LGSRYKKAVFREYTDGTFRIPRPRTGPEEHLGILG-PLIKGEVGDILTVVFKNNASRPYS 835

Query: 1210 LHPHGV 1227
            +H HGV
Sbjct: 836  VHAHGV 841

 Score = 35.0 bits (79), Expect(4) = 1e-35
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +1

Query: 1936 HVMAGMRAKYTVTANASRMVVNP-SGVTRTYYIQAEAVNWDYAPAGY 2073
            H   GM+A Y V + +    V+  +G  R Y+I+A  + WDY P G+
Sbjct: 352  HFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGH 398

 Score = 34.3 bits (77), Expect = 8.9
 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%)
 Frame = +1

Query: 1936 HVMAGMRAKYTVTANASRMVVNPSG--VTRTYYIQAEAVNWDYAP 2064
            H  AGMRA Y V+                R YYI AE V WDY P
Sbjct: 704  HREAGMRAIYNVSQCPGHQATPRQRYQAARIYYIMAEEVEWDYCP 748

 Score = 28.1 bits (61), Expect(4) = 1e-35
 Identities = 16/43 (37%), Positives = 22/43 (50%), Gaps = 1/43 (2%)
 Frame = +3

Query: 1830 GMHTDSIQISPGGMVSADVQMTSPGDYELQCRVCGP-RDGGHA 1955
            G HTD   I P   V+A++    PG + + C+V    RDG  A
Sbjct: 317  GHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQA 359

 Score = 20.8 bits (42), Expect(4) = 9e-29
 Identities = 8/20 (40%), Positives = 11/20 (55%)
 Frame = +1

Query: 1933 DHVMAGMRAKYTVTANASRM 1992
            DHV AGM   +TV +    +
Sbjct: 1050 DHVHAGMETLFTVFSRTEHL 1069

 Score = 20.8 bits (42), Expect(4) = 9e-29
 Identities = 7/29 (24%), Positives = 15/29 (51%)
 Frame = +3

Query: 1842 DSIQISPGGMVSADVQMTSPGDYELQCRV 1928
            D + + PG     ++  ++PG + + C V
Sbjct: 1020 DVVDLFPGTFEVVEMVASNPGTWLMHCHV 1048



EST assemble image


clone accession position
1 MXL074b12_r BP097345 1 275
2 CL48f10_r AV395796 85 583
3 MXL077h08_r BP097570 109 586
4 MXL060c03_r BP096528 235 620
5 CL23d04_r AV394462 345 891
6 LCL013f08_r AV626684 363 675
7 MXL095f08_r BP098569 378 847
8 HCL095b08_r AV644891 402 938
9 MXL097c11_r BP098681 559 1021
10 MXL079e08_r BP097680 560 939
11 HCL018e10_r AV640576 589 1089
12 HCL072b06_r AV643577 622 1059
13 MXL008h01_r BP093470 628 1131
14 LCL072b03_r AV630054 783 1138
15 LCL077f11_r AV630352 791 1272
16 CL16d04_r AV394010 1022 1432
17 HCL071f10_r AV643558 1293 1780
18 LC011a11_r AV619634 1457 1909
19 HC007h06_r AV632411 1755 2117




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research