KCC000280A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000280A_C01 KCC000280A_c01
ggACAATTAAGCATATTACATAAATAGAGCAAGACTCGACCGAACGTGCCGCAAGTGCCG
TTTACAAAGCTTCCAAAACTGTTCGCAGTAACCACAACCTAAACTTAAGAAGAGTACATT
GAAGCTTAGAAGTCGCCCAGGACGCTGAATGCCGACTTGTTGAGCATATTTTGCGGAGTC
CCAGCAGCTCAGCAAGGATGGCGGAGGACGCTGGCCCTTCAAAGCCCAGCGAGGAGCTGG
AGAACCGCGCTTATGAGGCCCTTGAGCGGGACTTCCAGGAGGTGCTTCAAGAGCTGGTGG
GCGACAAGAGCCTGGAGCGCTTTCGGATAGAGTACGAGAAATTACATCGGGCGCTGAAGA
AGTCTCATGAGAGCGAGAAGCGGCTCATTAAGAAATGCCGGGAGCTGAACGCGGAGATCG
TGGCGAATGCCGCCAAGGTGCAGACTGCGTTGAAGCTGAACGAGGAGGACCAGCAGACCA
TTGGAGCGCTGAAGAAGGAGATCGAGAAGGCCTGGAAGATGGTGGACGCCAGCCATGAGA
AGGAGGCGAAGGCGAAGGAGACCATCCAGCAGCTAAAGATCGAAATCGCCAACCTCACGC
GCCTAGTGGAGCAGGGCGCGGGCCTGGCGATCGGCGAGGAGACCACGCTGAACGAGCTGC
TGAAGCAGAAGGAGGAGCTGGTGCGGGAGCGCGATGCGCAGGTGGACCAGATCATGCAGC
TGCGGTCAGACCTGATGGAGATGCAGGAGAAGCAGCGCACGGCGGAGGCGGACAAGCTGC
AGCTCGATATGGACATCCAGCAGCTGAAGGACTCGGTGGCGGAGAAGAAGGCGGAGGCGG
AGCGCGAGATCCGCAAGAAGGAGCGCATGGAGAAGGAGATGAAGGAGCTGCGGCAGCAGC
TGGAGATCCGCAGCAGCGAGATCAAGACGAAGCAGCTGCAGATGACGTCGACGGAGGAGC
AGGTGGCGAAGCTGGAGCAGATGGTGCGGGACTCCAAGGCGGCGACGGAGAAGGTGCAGA
AGGAGTACAACATGCTAAACGA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000280A_C01 KCC000280A_c01
         (1042 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_219988.2| similar to CG5882-PA [Rattus norvegicus]             284  2e-75
dbj|BAC04102.1| unnamed protein product [Homo sapiens]                280  4e-74
ref|XP_089747.2| similar to CG5882-PA [Homo sapiens]                  280  4e-74
gb|EAA43024.1| GLP_170_182668_185370 [Giardia lamblia ATCC 50803]     191  2e-47
ref|XP_340400.1| hypothetical protein Tb927.2.3020 [Trypanosoma ...   142  9e-33

>ref|XP_219988.2| similar to CG5882-PA [Rattus norvegicus]
          Length = 1094

 Score =  284 bits (727), Expect = 2e-75
 Identities = 139/262 (53%), Positives = 200/262 (76%)
 Frame = +3

Query: 240  ENRAYEALERDFQEVLQELVGDKSLERFRIEYEKLHRALKKSHESEKRLIKKCRELNAEI 419
            E  A+E +E+DFQEVL EL GDKSLE+FR+EYEKLH  +KKS+E+EKRL+ KCRELNAEI
Sbjct: 166  EETAFEEIEKDFQEVLSELSGDKSLEKFRVEYEKLHTIMKKSYENEKRLMAKCRELNAEI 225

Query: 420  VANAAKVQTALKLNEEDQQTIGALKKEIEKAWKMVDASHEKEAKAKETIQQLKIEIANLT 599
            V N+AKV TALKL+++DQ TI +LKKEIEKAWKMVD++++KE KAKETI  LK EI NLT
Sbjct: 226  VVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAKETILALKEEIVNLT 285

Query: 600  RLVEQGAGLAIGEETTLNELLKQKEELVRERDAQVDQIMQLRSDLMEMQEKQRTAEADKL 779
            +L+EQG+GL++ +++ + +LLK KEE+ RERD  + ++++LR +L ++ EKQ+ AE  K 
Sbjct: 286  KLIEQGSGLSMDQDSNIRDLLKFKEEVTRERDQLLTEVVKLRENLAQITEKQQAAERAKE 345

Query: 780  QLDMDIQQLKDSVAEKKAEAEREIRKKERMEKEMKELRQQLEIRSSEIKTKQLQMTSTEE 959
            + +  I Q +  +  ++ EA RE RKKE++EKE+K+++  ++ R SEIK  Q  M  ++E
Sbjct: 346  EAEHAISQFQQEIQHRQNEASRESRKKEKLEKELKQIQLDMDGRQSEIKAMQQYMHKSKE 405

Query: 960  QVAKLEQMVRDSKAATEKVQKE 1025
            ++ +LEQ +++ K   E+  KE
Sbjct: 406  ELQRLEQQLKEQKILNERAAKE 427

 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 43/224 (19%), Positives = 103/224 (45%), Gaps = 9/224 (4%)
 Frame = +3

Query: 324 RIEYEKLHRALKKSHESEKR--LIKKCRELNAEIVANAAKVQTALKLNEEDQQTIGALKK 497
           + + E  HR  + S ES K+  L K+ +++  ++    ++++         QQ +   K+
Sbjct: 353 QFQQEIQHRQNEASRESRKKEKLEKELKQIQLDMDGRQSEIKAM-------QQYMHKSKE 405

Query: 498 EIEKAWKMVDASHEKEAKAKETIQQLKIEIANLTRLVEQGAGLAIGEETTLNELLKQKEE 677
           E+++  + +        +A + ++Q ++    L +  EQ          T  +L ++ ++
Sbjct: 406 ELQRLEQQLKEQKILNERAAKEVEQFQLRNMKLQQENEQ-------HTLTCEQLSQENQQ 458

Query: 678 LVRERDAQVDQIMQLRSDL-------MEMQEKQRTAEADKLQLDMDIQQLKDSVAEKKAE 836
              E  A+ D+I Q+R DL        ++ +K R  +  K++++   + LK+ +   + E
Sbjct: 459 KALELKAKEDEIHQMRLDLGKLNKIREQIHKKLRLIDDQKIEVEQQKETLKNQILGLERE 518

Query: 837 AEREIRKKERMEKEMKELRQQLEIRSSEIKTKQLQMTSTEEQVA 968
            E   ++ E  +K M+EL ++ +I +  +    L +    + +A
Sbjct: 519 VESSKKQAELDKKAMEELLRERDILNKVLDVLNLHIDPLGQNLA 562

 Score = 41.2 bits (95), Expect = 0.030
 Identities = 42/229 (18%), Positives = 104/229 (45%), Gaps = 1/229 (0%)
 Frame = +3

Query: 354  LKKSHESEKRLIKKCRELNAEIVANAAKVQTALKLNEEDQQTIGALKKEIEKAWKMVDAS 533
            L K HE  KR +++             ++Q      ++ ++ I  L+KE ++        
Sbjct: 628  LVKLHEQAKRNLEE-------------EIQNYKDEAQKQRKIIFQLEKERDRYINEASDL 674

Query: 534  HEKEAKAKETIQQLKIEIANLTRLVEQGAGLAIGEETTLNELLKQKEELVRERDAQVDQI 713
             ++     E I+  +I+I +  + + +        ET L +     E +  +R+     +
Sbjct: 675  TQRVLANMEDIKVREIQIFDYRKKIAES-------ETKLKQQQNLYEAVRSDRNLYSKNL 727

Query: 714  MQLRSDLMEMQEKQRTAEADKLQLDMDIQQLKDSVAEKKAEAEREIRKKERMEKEMKELR 893
            ++ + ++ EM+ K +        +   + QLK+ ++ K+A   +   +++R+EKE + L+
Sbjct: 728  VEAQDEITEMKRKLKI-------MTHQVDQLKEEISAKEAALVKLHLEQQRIEKEKETLK 780

Query: 894  QQLE-IRSSEIKTKQLQMTSTEEQVAKLEQMVRDSKAATEKVQKEYNML 1037
             +L+ +R   ++TK   +   E +  KL +++ ++     + +KE + +
Sbjct: 781  AELQKLRQQALETKHF-IEKQEVEERKLLRIIAEADGERLRQKKELDQV 828

>dbj|BAC04102.1| unnamed protein product [Homo sapiens]
          Length = 550

 Score =  280 bits (715), Expect = 4e-74
 Identities = 139/276 (50%), Positives = 203/276 (73%)
 Frame = +3

Query: 198  MAEDAGPSKPSEELENRAYEALERDFQEVLQELVGDKSLERFRIEYEKLHRALKKSHESE 377
            MAE+ G     + LE  A+E +ERDFQ VL EL GDKSLE+FRIEYE+LH  +KKS+++E
Sbjct: 1    MAEEKGGK---QVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNE 57

Query: 378  KRLIKKCRELNAEIVANAAKVQTALKLNEEDQQTIGALKKEIEKAWKMVDASHEKEAKAK 557
            KRL+ KCRELNAEIV N+AKV TALKL+++DQ TI +LKKEIEKAWKMVD++++KE KAK
Sbjct: 58   KRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAK 117

Query: 558  ETIQQLKIEIANLTRLVEQGAGLAIGEETTLNELLKQKEELVRERDAQVDQIMQLRSDLM 737
            ETI  LK EI NLT+LVEQG+GL++ + + + +LL+ KEE+ +ERD  + ++++LR  L 
Sbjct: 118  ETILALKEEIVNLTKLVEQGSGLSMDQHSNIRDLLRFKEEVTKERDQLLSEVVKLRESLA 177

Query: 738  EMQEKQRTAEADKLQLDMDIQQLKDSVAEKKAEAEREIRKKERMEKEMKELRQQLEIRSS 917
            +  E+Q+  E  K + +  I Q +  + +++ EA RE RKKE++EKE+K+++  ++ R +
Sbjct: 178  QTTEQQQETERSKEEAEHAISQFQQEIQQRQNEASREFRKKEKLEKELKQIQADMDSRQT 237

Query: 918  EIKTKQLQMTSTEEQVAKLEQMVRDSKAATEKVQKE 1025
            EIK  Q  +  ++E++ KLEQ +++ K   E+  KE
Sbjct: 238  EIKALQQYVQKSKEELQKLEQQLKEQKILNERAAKE 273

>ref|XP_089747.2| similar to CG5882-PA [Homo sapiens]
          Length = 872

 Score =  280 bits (715), Expect = 4e-74
 Identities = 139/276 (50%), Positives = 203/276 (73%)
 Frame = +3

Query: 198  MAEDAGPSKPSEELENRAYEALERDFQEVLQELVGDKSLERFRIEYEKLHRALKKSHESE 377
            MAE+ G     + LE  A+E +ERDFQ VL EL GDKSLE+FRIEYE+LH  +KKS+++E
Sbjct: 1    MAEEKGGK---QVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNE 57

Query: 378  KRLIKKCRELNAEIVANAAKVQTALKLNEEDQQTIGALKKEIEKAWKMVDASHEKEAKAK 557
            KRL+ KCRELNAEIV N+AKV TALKL+++DQ TI +LKKEIEKAWKMVD++++KE KAK
Sbjct: 58   KRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAK 117

Query: 558  ETIQQLKIEIANLTRLVEQGAGLAIGEETTLNELLKQKEELVRERDAQVDQIMQLRSDLM 737
            ETI  LK EI NLT+LVEQG+GL++ + + + +LL+ KEE+ +ERD  + ++++LR  L 
Sbjct: 118  ETILALKEEIVNLTKLVEQGSGLSMDQHSNIRDLLRFKEEVTKERDQLLSEVVKLRESLA 177

Query: 738  EMQEKQRTAEADKLQLDMDIQQLKDSVAEKKAEAEREIRKKERMEKEMKELRQQLEIRSS 917
            +  E+Q+  E  K + +  I Q +  + +++ EA RE RKKE++EKE+K+++  ++ R +
Sbjct: 178  QTTEQQQETERSKEEAEHAISQFQQEIQQRQNEASREFRKKEKLEKELKQIQADMDSRQT 237

Query: 918  EIKTKQLQMTSTEEQVAKLEQMVRDSKAATEKVQKE 1025
            EIK  Q  +  ++E++ KLEQ +++ K   E+  KE
Sbjct: 238  EIKALQQYVQKSKEELQKLEQQLKEQKILNERAAKE 273

 Score = 40.0 bits (92), Expect = 0.066
 Identities = 56/276 (20%), Positives = 118/276 (42%), Gaps = 28/276 (10%)
 Frame = +3

Query: 255  EALERDFQEVLQELVGDKS-LERFRIEYEKLHRALKKSHESEKRLIKKCRELNAEIVANA 431
            E L+ + Q++ Q+ +  K  +E+   E  KL R +    E++   +++ +EL+  I    
Sbjct: 555  ETLKAELQKLRQQALETKHFIEKQEAEERKLLRIIA---EADGERLRQKKELDQVISERD 611

Query: 432  AKVQTALKLNEEDQQTIGALKKEIEKAWKMVDASHEKEAKAKETIQQLKIEIANLTRLVE 611
                  ++ N+E    +  L ++I+    +++    +  +  E ++ L++EI  L R   
Sbjct: 612  ILGSQLVRRNDE----LALLYEKIKIQQSVLNKGESQYNQRLEDMRILRLEIKKLRREKG 667

Query: 612  QGAGLAIGEETTLNELLKQKEELVRERDAQVDQIMQLRSDL-MEMQEKQRTAEADKLQLD 788
              A      E    E    + EL++ER        +L + L +    K   ++ +  +L 
Sbjct: 668  ILARSMANVEELRQEFFHMQRELLKERTRCRALEEELENPLNVHRWRKLEASDPNAYELI 727

Query: 789  MDIQQLKD---SVAEKKAEAEREIRKKERMEKEMKEL----------------------- 890
              I  L+    S  E+  E E  +++KE++  E+K +                       
Sbjct: 728  QKIHTLQKRLISKTEEVVEKELLLQEKEKLYMELKHVLARQPGPEAAEQLKLYRRTLHDK 787

Query: 891  RQQLEIRSSEIKTKQLQMTSTEEQVAKLEQMVRDSK 998
            +QQL++ SSE+   ++Q    + +V KL   +++ K
Sbjct: 788  KQQLKVLSSELNMYEVQSKEYKYEVEKLTNELQNLK 823

>gb|EAA43024.1| GLP_170_182668_185370 [Giardia lamblia ATCC 50803]
          Length = 900

 Score =  191 bits (485), Expect = 2e-47
 Identities = 100/277 (36%), Positives = 175/277 (63%), Gaps = 10/277 (3%)
 Frame = +3

Query: 237  LENRAYEALERDFQEVLQELVGDKSLERFRIEYEKLHRALKKSHESEKRLIKKCRELNAE 416
            +++ A+ A+ERDF EVL ELVGD SL+ FR EYEKLH AL+KSHE+EK L+++ REL   
Sbjct: 22   IDDAAFAAIERDFHEVLAELVGDSSLDLFRTEYEKLHTALRKSHENEKLLVQRVRELAQN 81

Query: 417  IVANAAKVQTALKLNEEDQQTIGALKKEIEKAWKMVDASHEKEAKAKETIQQLKIEIANL 596
            +  N  K++TAL+L++EDQ TI +LK EI+KAWK+VD + EKE    E I +L+ E+ +L
Sbjct: 82   LSINNQKIKTALRLSKEDQSTISSLKAEIDKAWKIVDLAREKEGVQTEQIDKLRAEVQSL 141

Query: 597  TRLVE---QGAGLAIGEETTLNELLKQKEELVRERDAQVDQIMQLRSDLMEMQEKQRTAE 767
              +++    G  + + EE  + +LL+ K  L +E + +  +I  LR +L +  ++ +  E
Sbjct: 142  RGMIDTATAGTNVGVPEEQNIEDLLRAKAVLQQEYENRGKRISLLREELNQHLDRIKQLE 201

Query: 768  ADKLQLDMDIQQLKDSVAEKKAEAEREIRKKERMEKEMKELRQQLEIRSSEIKTKQLQMT 947
            ++K+  ++ ++ LK+ VA+ ++EA RE++++E +++E+  LR + E    +I  K+  + 
Sbjct: 202  SEKVSSELRVRALKEQVAQHRSEAARELQRREHLDRELASLRLKCENLERDIANKEQDVN 261

Query: 948  STEEQVAKLE-------QMVRDSKAATEKVQKEYNML 1037
              + ++ K E       + ++ +KA    +Q + + L
Sbjct: 262  HLKTELTKAETRSGQEYEELQKTKATISSLQDKIHKL 298

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 62/288 (21%), Positives = 122/288 (41%), Gaps = 18/288 (6%)
 Frame = +3

Query: 231  EELENRAYEALERDFQEVLQELVGDKSLERFRIEYEKLHRALKKS---HESEK-RLIKKC 398
            +E ENR  + +    +E+ Q L   K LE  ++  E   RALK+    H SE  R +++ 
Sbjct: 174  QEYENRG-KRISLLREELNQHLDRIKQLESEKVSSELRVRALKEQVAQHRSEAARELQRR 232

Query: 399  RELNAEIVANAAKVQTALKLNEEDQQTIGALKKEIEKAWKMVDASHEKEAKAKETIQQLK 578
              L+ E+ +   K +   +     +Q +  LK E+ KA       +E+  K K TI  L+
Sbjct: 233  EHLDRELASLRLKCENLERDIANKEQDVNHLKTELTKAETRSGQEYEELQKTKATISSLQ 292

Query: 579  IEI----ANLTRLVEQGAGLAIG---EETTLNELLKQKEELVRERDAQVDQIMQLRSDLM 737
             +I    A+L+    Q   L      +ET + + L++  +   E       +  L+S L 
Sbjct: 293  DKIHKLKADLSEANRQSTNLQSSNAEKETQIQQHLQEAAQARAEAAKAQKTLTSLQSKLD 352

Query: 738  EMQ-------EKQRTAEADKLQLDMDIQQLKDSVAEKKAEAEREIRKKERMEKEMKELRQ 896
             ++       EK    +    Q + +++QLK    E   E ++  R+ + + K +   + 
Sbjct: 353  SLEIAKHNTEEKVEQLKGQLTQAEQELKQLKHENNEIGREHDQLSREAQLVGKSLHVAQV 412

Query: 897  QLEIRSSEIKTKQLQMTSTEEQVAKLEQMVRDSKAATEKVQKEYNMLN 1040
             +  +   +K  + Q  + E+++       +  +     ++KE  M +
Sbjct: 413  SIADKDDLLKRMENQAKNYEQEILSFRNESQKQRKIIFSLEKEREMFS 460

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 70/337 (20%), Positives = 137/337 (39%), Gaps = 1/337 (0%)
 Frame = +3

Query: 30   QDSTERAASAVYKASKTVRSNHNLNLRRVH*SLEVAQDAECRLVEHILRSPSSSARMAED 209
            Q++ +  A A  KA KT+ S     L+    SLE+A+      VE +          AE 
Sbjct: 328  QEAAQARAEAA-KAQKTLTS-----LQSKLDSLEIAKHNTEEKVEQL----KGQLTQAEQ 377

Query: 210  AGPSKPSEELE-NRAYEALERDFQEVLQELVGDKSLERFRIEYEKLHRALKKSHESEKRL 386
                   E  E  R ++ L R+ Q     LVG KSL   ++        LK+     K  
Sbjct: 378  ELKQLKHENNEIGREHDQLSREAQ-----LVG-KSLHVAQVSIADKDDLLKRMENQAKNY 431

Query: 387  IKKCRELNAEIVANAAKVQTALKLNEEDQQTIGALKKEIEKAWKMVDASHEKEAKAKETI 566
             ++      E              +++ ++ I +L+KE E   +    + +K  +A + I
Sbjct: 432  EQEILSFRNE--------------SQKQRKIIFSLEKEREMFSQKSTEAQQKYLQAVQEI 477

Query: 567  QQLKIEIANLTRLVEQGAGLAIGEETTLNELLKQKEELVRERDAQVDQIMQLRSDLMEMQ 746
            +   + I++L + V   A + + ++  L E ++       +R+     +++ + ++ E++
Sbjct: 478  RVRDLAISDLQKRVSD-ADVKLKQQQALYESVRS------DRNLYSKSLVEAQDEVSELR 530

Query: 747  EKQRTAEADKLQLDMDIQQLKDSVAEKKAEAEREIRKKERMEKEMKELRQQLEIRSSEIK 926
             K R        L   I QLK  +  K     +E    +   KE     Q+LE    +++
Sbjct: 531  RKFRV-------LSHVIDQLKSEIQTKDESLLKEHFAHKSALKEKDSTVQELERTRQQVR 583

Query: 927  TKQLQMTSTEEQVAKLEQMVRDSKAATEKVQKEYNML 1037
              +  +     ++AKL  ++ +S    ++  KEY ++
Sbjct: 584  EAEEALAIQRTEIAKLNCIITESDMERDRQMKEYRIV 620

>ref|XP_340400.1| hypothetical protein Tb927.2.3020 [Trypanosoma brucei]
            gi|33348433|gb|AAQ15759.1| hypothetical protein
            Tb927.2.3020 [Trypanosoma brucei]
          Length = 1032

 Score =  142 bits (358), Expect = 9e-33
 Identities = 83/261 (31%), Positives = 145/261 (54%)
 Frame = +3

Query: 240  ENRAYEALERDFQEVLQELVGDKSLERFRIEYEKLHRALKKSHESEKRLIKKCRELNAEI 419
            +N  +E  ER FQEVL  L  D+ L  FR EY  L+ +  KSH+ E RL+KKC EL A+I
Sbjct: 32   DNLNFEYYERQFQEVLMSLENDEVLAAFRTEYASLYHSFLKSHDGESRLLKKCIELQADI 91

Query: 420  VANAAKVQTALKLNEEDQQTIGALKKEIEKAWKMVDASHEKEAKAKETIQQLKIEIANLT 599
               ++K+ TA +L+  D+ TI  L+ EIEK  K +D + E+EA  K+ +  L+ E+ +L 
Sbjct: 92   DTCSSKLVTADELSRGDKNTIDTLRIEIEKTRKKIDVTKEREAALKDKVAALRRELRDLE 151

Query: 600  RLVEQGAGLAIGEETTLNELLKQKEELVRERDAQVDQIMQLRSDLMEMQEKQRTAEADKL 779
                    L   ++  +  L +  E + +ER+ Q  Q+  LR D   ++++       K 
Sbjct: 152  EKSHLQVELT-SQKAAMQSLQRTLETVTKERELQALQLSSLRQDYSLLEKRMERLREVKD 210

Query: 780  QLDMDIQQLKDSVAEKKAEAEREIRKKERMEKEMKELRQQLEIRSSEIKTKQLQMTSTEE 959
              DM++Q+++ ++ EK+ EA+     + R E+E++ELRQ +  R++ ++ +Q   T+ E+
Sbjct: 211  SGDMELQKMRSAIDEKQEEADVHKALRLRKEEELRELRQDITQRAASVQERQ---TAIEK 267

Query: 960  QVAKLEQMVRDSKAATEKVQK 1022
               +  Q   D+K   +++ +
Sbjct: 268  LTEESSQHNVDTKRTLDEINR 288



EST assemble image


clone accession position
1 LCL091g11_r AV631308 1 168
2 MXL078b11_r BP097593 3 497
3 MXL087b06_r BP098104 12 383
4 LCL032b04_r AV627792 24 323
5 CL33g11_r AV394946 30 542
6 HCL054c10_r AV642588 37 530
7 CL16c03_r AV394014 174 677
8 HCL072f06_r AV643605 543 1028
9 HCL072h08_r AV643622 543 1042




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research