KCC000276A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000276A_C01 KCC000276A_c01
ttggtagcggcccaTTCATAATTGCATACAGACTGTGCAAACACATCGTTTGTGACGAGA
ACGCGGTCCTCTTGAAACTTGACTCGAAATTATGCGCAATAGACGACCATGAAGGCATCA
GGAGGACCGCAGAAGCTGCGGTTTACCATTCACGCGTGCTCGGGCGAGGACACGGACTAT
CCTGTTCGCGAACTCCTCTACCACAGCCCGCAGACGCGTGGATGGCAGTCGCCCAGGTTC
TGCAAATACCCTCAGGAGATCGTCCTGCGCTTGGAGCAGACGTGCAAAGTGCAGCAGATT
CAGATTTTGGCGCATGAGTATAAGATTGCGACACGGGTGGAGGTGTTCGTGGGCGCACCC
CAGAACCCGCTCGACACCGACCCCAACAACTGTATCTTCAAGCGCCTGGGCTACCTGTCG
TTCGACAGCAATGAGCGCAGCAACCACCAGGCGCGCGAGCTGAAGAGCGTGCACGTCAAC
GTGCAGGCCTTCCT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000276A_C01 KCC000276A_c01
         (494 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_055519.1| KIAA0562 gene product [Homo sapiens] gi|2014043...   108  3e-23
gb|AAH50721.1| Similar to KIAA0562 gene product [Homo sapiens]        108  3e-23
gb|AAH47450.1| Similar to KIAA0562 gene product [Homo sapiens]        108  3e-23
gb|AAH01640.1| Unknown (protein for IMAGE:2958798) [Homo sapiens]     108  4e-23
ref|NP_808341.1| hypothetical protein A930027E11 [Mus musculus] ...   108  5e-23

>ref|NP_055519.1| KIAA0562 gene product [Homo sapiens]
           gi|20140432|sp|O60308|Y562_HUMAN Hypothetical protein
           KIAA0562 gi|7513020|pir||T00334 hypothetical protein
           KIAA0562 - human gi|3043648|dbj|BAA25488.1| KIAA0562
           protein [Homo sapiens]
          Length = 925

 Score =  108 bits (271), Expect = 3e-23
 Identities = 47/118 (39%), Positives = 80/118 (66%)
 Frame = +1

Query: 127 PQKLRFTIHACSGEDTDYPVRELLYHSPQTRGWQSPRFCKYPQEIVLRLEQTCKVQQIQI 306
           P K+ F + + SG +  +  REL+ H+P   GW+SPRFC++PQEIVL++ + C+++++Q+
Sbjct: 2   PHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQL 61

Query: 307 LAHEYKIATRVEVFVGAPQNPLDTDPNNCIFKRLGYLSFDSNERSNHQARELKSVHVN 480
           LAH+Y I++++E ++               F+RLGY+S   NE++  +ARELKSV+V+
Sbjct: 62  LAHQYMISSKIEFYISESLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVD 119

>gb|AAH50721.1| Similar to KIAA0562 gene product [Homo sapiens]
          Length = 244

 Score =  108 bits (271), Expect = 3e-23
 Identities = 47/118 (39%), Positives = 80/118 (66%)
 Frame = +1

Query: 127 PQKLRFTIHACSGEDTDYPVRELLYHSPQTRGWQSPRFCKYPQEIVLRLEQTCKVQQIQI 306
           P K+ F + + SG +  +  REL+ H+P   GW+SPRFC++PQEIVL++ + C+++++Q+
Sbjct: 2   PHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQL 61

Query: 307 LAHEYKIATRVEVFVGAPQNPLDTDPNNCIFKRLGYLSFDSNERSNHQARELKSVHVN 480
           LAH+Y I++++E ++               F+RLGY+S   NE++  +ARELKSV+V+
Sbjct: 62  LAHQYMISSKIEFYISESLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVD 119

>gb|AAH47450.1| Similar to KIAA0562 gene product [Homo sapiens]
          Length = 554

 Score =  108 bits (271), Expect = 3e-23
 Identities = 47/118 (39%), Positives = 80/118 (66%)
 Frame = +1

Query: 127 PQKLRFTIHACSGEDTDYPVRELLYHSPQTRGWQSPRFCKYPQEIVLRLEQTCKVQQIQI 306
           P K+ F + + SG +  +  REL+ H+P   GW+SPRFC++PQEIVL++ + C+++++Q+
Sbjct: 2   PHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQL 61

Query: 307 LAHEYKIATRVEVFVGAPQNPLDTDPNNCIFKRLGYLSFDSNERSNHQARELKSVHVN 480
           LAH+Y I++++E ++               F+RLGY+S   NE++  +ARELKSV+V+
Sbjct: 62  LAHQYMISSKIEFYISESLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVD 119

>gb|AAH01640.1| Unknown (protein for IMAGE:2958798) [Homo sapiens]
          Length = 701

 Score =  108 bits (270), Expect = 4e-23
 Identities = 47/118 (39%), Positives = 80/118 (66%)
 Frame = +1

Query: 127 PQKLRFTIHACSGEDTDYPVRELLYHSPQTRGWQSPRFCKYPQEIVLRLEQTCKVQQIQI 306
           P K+ F + + SG +  +  REL+ H+P   GW+SPRFC++PQEIVL++ + C+++++Q+
Sbjct: 2   PHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMLERCRIRKLQL 61

Query: 307 LAHEYKIATRVEVFVGAPQNPLDTDPNNCIFKRLGYLSFDSNERSNHQARELKSVHVN 480
           LAH+Y I++++E ++               F+RLGY+S   NE++  +ARELKSV+V+
Sbjct: 62  LAHQYMISSKIEFYISESLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVD 119

>ref|NP_808341.1| hypothetical protein A930027E11 [Mus musculus]
           gi|28279376|gb|AAH46331.1| Hypothetical protein
           A930027E11 [Mus musculus]
          Length = 926

 Score =  108 bits (269), Expect = 5e-23
 Identities = 48/118 (40%), Positives = 80/118 (67%)
 Frame = +1

Query: 127 PQKLRFTIHACSGEDTDYPVRELLYHSPQTRGWQSPRFCKYPQEIVLRLEQTCKVQQIQI 306
           P K+ F + + SG +  +  REL+ H+P   GW+SP+FC++PQEIVL++ + C+V+++Q+
Sbjct: 2   PHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPKFCQFPQEIVLQMVERCRVRKLQL 61

Query: 307 LAHEYKIATRVEVFVGAPQNPLDTDPNNCIFKRLGYLSFDSNERSNHQARELKSVHVN 480
           LAH+Y I+++VE ++               F+RLGY+S   NE++  +ARELKSV+V+
Sbjct: 62  LAHQYMISSKVEFYISESLPEYLVPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVD 119



EST assemble image


clone accession position
1 MXL016a06_r BP093942 1 461
2 MXL025e04_r BP094601 15 432
3 CL15h11_r AV393979 17 494
4 LCL055f06_r AV629268 29 475
5 LCL037a02_r AV628117 31 363
6 LCL035d09_r AV628016 38 482
7 CL20f03_r AV394282 50 452
8 LCL015h10_r AV626817 54 320




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research