KCC000275A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000275A_C01 KCC000275A_c01
CAGAGATGGCGAACAAACGCAAGGGTGGCACGTCGGGTAACAAGTTCCGCATGGCCCTGG
GTCTCCCAGTGGCCGCGGTCATGAACTGCGCCGACAACACGGGCGCCAAGAACCTGTACG
TCATCTCGGTGGTCGGCTGGGGCAGCAGGCTGAACAAGCTGCCCGCCGCCGCCTGCGGCG
ACATGGTCATGGCTTCCGTCAAGAAGGGCAAGCCCGATCTGCGCAAGAAGGTGACCCCGG
CCGTGGTCATCCGCCAGCGCAAGCCCTTCCGCCGGAAGGAGGGTGTCTACATCTACTTCG
AGGACAACGCTGGCGTCATCGTCAACCCCAAGGGTGAGATGAAGGGCTCGGCCATCACTG
GCCCCGTGGCCAAGGAGTGCGCCGACCTGTGGCCCCGTATCGCCAGCGCGGCCAACTCGA
TCGTCTAAAGATTCTGCACGTGTAACGGTCCGCCTGTGAGAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAACTCGGGGGGGGCCGGTCC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000275A_C01 KCC000275A_c01
         (528 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_180895.1| 60S ribosomal protein L23 (RPL23B) [Arabidopsis...   236  1e-61
gb|AAM67199.1| putative 60S ribosomal protein L17 [Arabidopsis t...   235  2e-61
gb|AAK27802.1|AC022457_5 60S ribosomal protein L17 [Oryza sativa...   235  2e-61
pir||B86177 hypothetical protein [imported] - Arabidopsis thalia...   234  5e-61
gb|AAP80667.1|AF479048_1 ribosomal Pr 117 [Triticum aestivum]         234  7e-61

>ref|NP_180895.1| 60S ribosomal protein L23 (RPL23B) [Arabidopsis thaliana]
           gi|15229287|ref|NP_187090.1| 60S ribosomal protein L23
           (RPL23C) [Arabidopsis thaliana]
           gi|18390397|ref|NP_563707.1| 60S ribosomal protein L23
           (RPL23A) [Arabidopsis thaliana]
           gi|19884121|sp|P49690|RL23_ARATH 60S ribosomal protein
           L23 gi|25295197|pir||F84744 60S ribosomal protein L23
           [imported] - Arabidopsis thaliana
           gi|2459420|gb|AAB80655.1| 60S ribosomal protein L23
           [Arabidopsis thaliana] gi|7547099|gb|AAF63771.1|
           ribosomal protein L17, putative [Arabidopsis thaliana]
           gi|14596111|gb|AAK68783.1| 60S ribosomal protein L17
           [Arabidopsis thaliana] gi|15450856|gb|AAK96699.1| Strong
           similarity to 60S ribosomal protein L17 [Arabidopsis
           thaliana] gi|18377460|gb|AAL66896.1| unknown protein
           [Arabidopsis thaliana] gi|20148697|gb|AAM10239.1|
           similar to 60S ribosomal protein L17 [Arabidopsis
           thaliana] gi|21555625|gb|AAM63901.1| putative 60S
           ribosomal protein L17 [Arabidopsis thaliana]
           gi|21593801|gb|AAM65768.1| putative 60S ribosomal
           protein L17 [Arabidopsis thaliana]
          Length = 140

 Score =  236 bits (603), Expect = 1e-61
 Identities = 112/140 (80%), Positives = 129/140 (92%)
 Frame = +3

Query: 6   MANKRKGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNKLPAAACGDM 185
           M+ + +GGTSGNKFRM+LGLPVAA +NCADNTGAKNLY+ISV G   RLN+LP+A  GDM
Sbjct: 1   MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM 60

Query: 186 VMASVKKGKPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGP 365
           VMA+VKKGKPDLRKKV PAV++RQRKP+RRK+GV++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct: 61  VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP 120

Query: 366 VAKECADLWPRIASAANSIV 425
           + KECADLWPRIASAAN+IV
Sbjct: 121 IGKECADLWPRIASAANAIV 140

>gb|AAM67199.1| putative 60S ribosomal protein L17 [Arabidopsis thaliana]
          Length = 140

 Score =  235 bits (600), Expect = 2e-61
 Identities = 111/140 (79%), Positives = 129/140 (91%)
 Frame = +3

Query: 6   MANKRKGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNKLPAAACGDM 185
           M+ + +GGTSGNKFRM+LGLPVAA +NCADNTGAKNLY+ISV G   RLN+LP+A  GDM
Sbjct: 1   MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM 60

Query: 186 VMASVKKGKPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGP 365
           VMA+VKKGKPDLRKKV PAV++RQRKP+RRK+GV++YFEDNAGVIVNPKG+MKGSAITGP
Sbjct: 61  VMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGDMKGSAITGP 120

Query: 366 VAKECADLWPRIASAANSIV 425
           + KECADLWPRIASAAN+IV
Sbjct: 121 IGKECADLWPRIASAANAIV 140

>gb|AAK27802.1|AC022457_5 60S ribosomal protein L17 [Oryza sativa (japonica cultivar-group)]
           gi|31432581|gb|AAP54196.1| 60S ribosomal protein L17
           [Oryza sativa (japonica cultivar-group)]
          Length = 140

 Score =  235 bits (600), Expect = 2e-61
 Identities = 111/140 (79%), Positives = 129/140 (91%)
 Frame = +3

Query: 6   MANKRKGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNKLPAAACGDM 185
           M+ + +GG++GNKFRM+LGLPVAA +NCADNTGAKNLY+ISV G   RLN+LP+A  GDM
Sbjct: 1   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM 60

Query: 186 VMASVKKGKPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGP 365
           VMA+VKKGKPDLRKKV PAV++RQRKP+RRK+GVY+YFEDNAGVIVNPKGEMKGSAITGP
Sbjct: 61  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP 120

Query: 366 VAKECADLWPRIASAANSIV 425
           + KECADLWPRIASAAN+IV
Sbjct: 121 IGKECADLWPRIASAANAIV 140

>pir||B86177 hypothetical protein [imported] - Arabidopsis thaliana
           gi|2341028|gb|AAB70426.1| Strong similarity to 60S
           ribosomal protein L17 (gb|X01694). EST gb|AA042332 comes
           from this gene. [Arabidopsis thaliana]
          Length = 157

 Score =  234 bits (597), Expect = 5e-61
 Identities = 111/135 (82%), Positives = 126/135 (93%)
 Frame = +3

Query: 21  KGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNKLPAAACGDMVMASV 200
           +GGTSGNKFRM+LGLPVAA +NCADNTGAKNLY+ISV G   RLN+LP+A  GDMVMA+V
Sbjct: 23  RGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATV 82

Query: 201 KKGKPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGPVAKEC 380
           KKGKPDLRKKV PAV++RQRKP+RRK+GV++YFEDNAGVIVNPKGEMKGSAITGP+ KEC
Sbjct: 83  KKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKEC 142

Query: 381 ADLWPRIASAANSIV 425
           ADLWPRIASAAN+IV
Sbjct: 143 ADLWPRIASAANAIV 157

>gb|AAP80667.1|AF479048_1 ribosomal Pr 117 [Triticum aestivum]
          Length = 147

 Score =  234 bits (596), Expect = 7e-61
 Identities = 110/140 (78%), Positives = 129/140 (91%)
 Frame = +3

Query: 6   MANKRKGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNKLPAAACGDM 185
           M+ + +GG++GNKFRM+LGLPVAA +NCADNTGAKNLY+ISV G   RLN+LP+A  GDM
Sbjct: 8   MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM 67

Query: 186 VMASVKKGKPDLRKKVTPAVVIRQRKPFRRKEGVYIYFEDNAGVIVNPKGEMKGSAITGP 365
           VMA+VKKGKPDLRKKV PAV++RQRKP+RRK+GV++YFEDNAGVIVNPKGEMKGSAITGP
Sbjct: 68  VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGP 127

Query: 366 VAKECADLWPRIASAANSIV 425
           + KECADLWPRIASAAN+IV
Sbjct: 128 IGKECADLWPRIASAANAIV 147



EST assemble image


clone accession position
1 CM083g02_r AV392177 1 528
2 HCL034c11_r AV641477 1 447
3 HCL093b10_r AV644742 1 446
4 CL62c11_r AV396447 4 337
5 CL63a10_r AV396506 5 505
6 CL58e07_r AV396223 5 460
7 HCL011d07_r AV640159 8 449
8 CL42g05_r AV395466 14 458
9 HCL012h08_r AV640242 14 329
10 CL15g08_r AV393950 18 458
11 CL35h05_r AV395078 20 458
12 CL64e06_r AV396661 20 458
13 CM001a06_r AV386498 28 510




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research