KCC000274A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000274A_C01 KCC000274A_c01
gcaccagaagcagtataacttgagccgtagattgctattttGCTACTCACATTTTGCCTG
GACTTGGCCTGGCTTTACCGAAATGAACTGCATGCTGCGAGGCTTCGCAATTTTGGGCTT
GCTCTGCTTCAACGCCGTAGTATCTTCTGCGAGGACTCTGCACGCTGCAGAGACCAACGT
CGCTGTGATTCAGGCGGCGGACACGGATGTCGACGTGGGCTCAGATGTGGGCTCATGGTG
GGGCAGGCGCGTGGAGGTGCTTCTGGCGGTCATGAGCCGCTGCCCCGACGGCAGGCGTGC
AGAGGCGCGCATCAACGAGGTCCTGGCCAAGGTCCACTCCATCGCCGACGTGCGCCTCAT
GTACATCGCCGCCAAGAACGAGTCCGCGCAGCCGCTGGGCGTCACCTGCAAGCACGGCGA
CCTGGAGTGCGCCGGCAATGCGCAGCAGCTGTGTGCCGCCTACTACGGCCGCCACGGCCA
CAGCTCCGGCACCACTGGCGGCGACCCGTGGACCCGCGGCTGGGACTTCATCATGTGTCA
GAACAAGTCGCGGCTGACTCGGGATGAGGACTGGCGAGCGGGTTGCGGAGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000274A_C01 KCC000274A_c01
         (591 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAO38851.1| sublingual apomucin [Mus musculus]                      52  8e-06
gb|AAO49800.1| MUC19 [Mus musculus]                                    52  8e-06
ref|XP_327283.1| predicted protein [Neurospora crassa] gi|289242...    50  3e-05
ref|ZP_00056820.1| COG2115: Xylose isomerase [Thermobifida fusca]      49  7e-05
ref|XP_128808.1| sine oculis-related homeobox 2 homolog [Mus mus...    48  1e-04

>gb|AAO38851.1| sublingual apomucin [Mus musculus]
          Length = 814

 Score = 51.6 bits (122), Expect = 8e-06
 Identities = 43/123 (34%), Positives = 60/123 (47%), Gaps = 10/123 (8%)
 Frame = +3

Query: 210 STWAQMWAHGGAGAWRCFWRS*AAAPTAGVQRRASTR-SWPRSTPSPTCASCTSPPRTSP 386
           ST  Q  A  G+        S AAA TAG    AS   S P ST  PT ++ T+ P +S 
Sbjct: 239 STSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTAGPTSSATTAAPASSS 298

Query: 387 RSRWASPASTA-TWSAPAMRSSCVPPTTAATAT--------APAPLAATRGPAAGTSSCV 539
            S   +PA TA + + PA+ ++    T+A  AT        + AP ++T G AA T+S  
Sbjct: 299 ASSATTPAETAGSTTGPAVSTTSAGSTSARAATTSPGGSSGSSAPASSTSGRAATTTSTA 358

Query: 540 RTS 548
            T+
Sbjct: 359 TTT 361

 Score = 51.6 bits (122), Expect = 8e-06
 Identities = 43/123 (34%), Positives = 60/123 (47%), Gaps = 10/123 (8%)
 Frame = +3

Query: 210 STWAQMWAHGGAGAWRCFWRS*AAAPTAGVQRRASTR-SWPRSTPSPTCASCTSPPRTSP 386
           ST  Q  A  G+        S AAA TAG    AS   S P ST  PT ++ T+ P +S 
Sbjct: 76  STSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTAGPTSSATTAAPASSS 135

Query: 387 RSRWASPASTA-TWSAPAMRSSCVPPTTAATAT--------APAPLAATRGPAAGTSSCV 539
            S   +PA TA + + PA+ ++    T+A  AT        + AP ++T G AA T+S  
Sbjct: 136 ASSATTPAETAGSTTGPAVSTTSAGSTSARAATTSPGGSSGSSAPASSTSGRAATTTSTA 195

Query: 540 RTS 548
            T+
Sbjct: 196 TTT 198

 Score = 42.4 bits (98), Expect = 0.005
 Identities = 36/114 (31%), Positives = 52/114 (45%), Gaps = 1/114 (0%)
 Frame = +3

Query: 207 MSTWAQMWAHGGAGAWRCFWRS*AAAPTAGVQRRASTR-SWPRSTPSPTCASCTSPPRTS 383
           +ST  Q  A  G+        S AAA TAG    AS   S P ST  PT ++ T+ P +S
Sbjct: 401 VSTSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTAGPTSSATTAAPASS 460

Query: 384 PRSRWASPASTATWSAPAMRSSCVPPTTAATATAPAPLAATRGPAAGTSSCVRT 545
                AS A+T   +A +     V  T+A + +A A   +  G +  +S  + T
Sbjct: 461 S----ASSATTLAETAGSTTGPAVSTTSAGSTSARAATTSPGGSSGSSSLAIST 510

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 3/94 (3%)
 Frame = +3

Query: 276 AAAPTAGVQRRASTRSWPRSTPSPTCASCTSPPRTSPRSRWASPASTATWSAPAMRSSCV 455
           A A T+G    ++  S   S+ S T A+ T+   T+  +  ++PASTA    P   ++  
Sbjct: 236 APASTSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTA---GPTSSATTA 292

Query: 456 PP--TTAATATAPAPLA-ATRGPAAGTSSCVRTS 548
            P  ++A++AT PA  A +T GPA  T+S   TS
Sbjct: 293 APASSSASSATTPAETAGSTTGPAVSTTSAGSTS 326

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 3/94 (3%)
 Frame = +3

Query: 276 AAAPTAGVQRRASTRSWPRSTPSPTCASCTSPPRTSPRSRWASPASTATWSAPAMRSSCV 455
           A A T+G    ++  S   S+ S T A+ T+   T+  +  ++PASTA    P   ++  
Sbjct: 73  APASTSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTA---GPTSSATTA 129

Query: 456 PP--TTAATATAPAPLA-ATRGPAAGTSSCVRTS 548
            P  ++A++AT PA  A +T GPA  T+S   TS
Sbjct: 130 APASSSASSATTPAETAGSTTGPAVSTTSAGSTS 163

 Score = 38.9 bits (89), Expect = 0.054
 Identities = 32/97 (32%), Positives = 46/97 (46%), Gaps = 6/97 (6%)
 Frame = +3

Query: 276 AAAPTAGVQRRASTRSWPRSTPSPTCASCTSPPRTSPRSRWASPASTA------TWSAPA 437
           A   T+G    ++  S   S+ S T A+ T+   T+  +  ++PASTA      T +APA
Sbjct: 399 APVSTSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTAGPTSSATTAAPA 458

Query: 438 MRSSCVPPTTAATATAPAPLAATRGPAAGTSSCVRTS 548
             S+    T A TA       +T GPA  T+S   TS
Sbjct: 459 SSSASSATTLAETA------GSTTGPAVSTTSAGSTS 489

>gb|AAO49800.1| MUC19 [Mus musculus]
          Length = 610

 Score = 51.6 bits (122), Expect = 8e-06
 Identities = 43/123 (34%), Positives = 60/123 (47%), Gaps = 10/123 (8%)
 Frame = +3

Query: 210 STWAQMWAHGGAGAWRCFWRS*AAAPTAGVQRRASTR-SWPRSTPSPTCASCTSPPRTSP 386
           ST  Q  A  G+        S AAA TAG    AS   S P ST  PT ++ T+ P +S 
Sbjct: 35  STSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTAGPTSSATTAAPASSS 94

Query: 387 RSRWASPASTA-TWSAPAMRSSCVPPTTAATAT--------APAPLAATRGPAAGTSSCV 539
            S   +PA TA + + PA+ ++    T+A  AT        + AP ++T G AA T+S  
Sbjct: 95  ASSATTPAETAGSTTGPAVSTTSAGSTSARAATTSPGGSSGSSAPASSTSGRAATTTSTA 154

Query: 540 RTS 548
            T+
Sbjct: 155 TTT 157

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 3/94 (3%)
 Frame = +3

Query: 276 AAAPTAGVQRRASTRSWPRSTPSPTCASCTSPPRTSPRSRWASPASTATWSAPAMRSSCV 455
           A A T+G    ++  S   S+ S T A+ T+   T+  +  ++PASTA    P   ++  
Sbjct: 32  APASTSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTA---GPTSSATTA 88

Query: 456 PP--TTAATATAPAPLA-ATRGPAAGTSSCVRTS 548
            P  ++A++AT PA  A +T GPA  T+S   TS
Sbjct: 89  APASSSASSATTPAETAGSTTGPAVSTTSAGSTS 122

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 36/113 (31%), Positives = 51/113 (44%), Gaps = 1/113 (0%)
 Frame = +3

Query: 210 STWAQMWAHGGAGAWRCFWRS*AAAPTAGVQRRASTR-SWPRSTPSPTCASCTSPPRTSP 386
           ST  Q  A  G+        S AAA TAG    AS   S P ST  PT ++ T+ P +S 
Sbjct: 198 STSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTAGPTSSATTAAPASSS 257

Query: 387 RSRWASPASTATWSAPAMRSSCVPPTTAATATAPAPLAATRGPAAGTSSCVRT 545
               AS A+T   +A +     V  T+A + +A A   +  G +  +S  + T
Sbjct: 258 ----ASSATTLAETAGSTTGPAVSTTSAGSTSARAATTSPGGSSGSSSLAIST 306

 Score = 40.4 bits (93), Expect = 0.019
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 6/97 (6%)
 Frame = +3

Query: 276 AAAPTAGVQRRASTRSWPRSTPSPTCASCTSPPRTSPRSRWASPASTA------TWSAPA 437
           A A T+G    ++  S   S+ S T A+ T+   T+  +  ++PASTA      T +APA
Sbjct: 195 APASTSGQPGASTGSSGTSSSVSSTAAATTAGTTTAASNETSAPASTAGPTSSATTAAPA 254

Query: 438 MRSSCVPPTTAATATAPAPLAATRGPAAGTSSCVRTS 548
             S+    T A TA       +T GPA  T+S   TS
Sbjct: 255 SSSASSATTLAETA------GSTTGPAVSTTSAGSTS 285

>ref|XP_327283.1| predicted protein [Neurospora crassa] gi|28924247|gb|EAA33401.1|
           predicted protein [Neurospora crassa]
          Length = 288

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 30/86 (34%), Positives = 41/86 (46%), Gaps = 1/86 (1%)
 Frame = +2

Query: 203 TDVDVGSDVGSWWGRRVEVLLAVMSRCPDGRRA-EARINEVLAKVHSIADVRLMYIAAKN 379
           TD+DVG D        V +   +MS+CPD R      +   + +VH+  +  L +I    
Sbjct: 90  TDIDVGGDDADH--EPVPLEAHIMSKCPDARDCFRELVLPAMQRVHTKVNFTLSFIGTPT 147

Query: 380 ESAQPLGVTCKHGDLECAGNAQQLCA 457
                 GV CKHG  EC GN  +LCA
Sbjct: 148 NGDD--GVACKHGPEECLGNIIELCA 171

>ref|ZP_00056820.1| COG2115: Xylose isomerase [Thermobifida fusca]
          Length = 754

 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 32/88 (36%), Positives = 45/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 282 APTAGVQRRASTRSWPRSTPSPTCASCTSPPRTSPRSRWASPASTATWSA---PAMRSSC 452
           AP A      ST + P + P+P  AS  SP  TSP   W +P+S A  +A   P+  SS 
Sbjct: 209 APAASSSCPTSTANAPPTCPTPPAASTASPEPTSPPPTWPAPSSKACSAASLTPSTPSST 268

Query: 453 -VPPTTAATATAPAPLAATRGPAAGTSS 533
            V P+T ++++A AP      P+   SS
Sbjct: 269 KVSPSTVSSSSAAAPAPPQSAPSPPKSS 296

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 30/95 (31%), Positives = 39/95 (40%), Gaps = 16/95 (16%)
 Frame = +3

Query: 309 ASTRSWPRSTPSPTCASCTSPPRTSPRSRWASPASTATW----------------SAPAM 440
           ++  S PR +P P  +S  SPP  SP S  ++PA   TW                SAP  
Sbjct: 86  SAANSAPRESPPPPKSSAASPPPNSPPSTSSAPAPATTWPPHSPSTPDPATSSSPSAPPE 145

Query: 441 RSSCVPPTTAATATAPAPLAATRGPAAGTSSCVRT 545
             S  P     T  AP+P + T   A+  SS   T
Sbjct: 146 PPSPSPKNPPPTPPAPSPDSPTPPDASSPSSAPST 180

 Score = 38.9 bits (89), Expect = 0.054
 Identities = 33/86 (38%), Positives = 38/86 (43%), Gaps = 12/86 (13%)
 Frame = +3

Query: 327 PRSTPSPTCASCTSPPRTSPRS------RWASPASTATWS------APAMRSSCVPPTTA 470
           P S   P  +S +S P T P S      R ASP+  +T S      APA  SSC   T  
Sbjct: 163 PDSPTPPDASSPSSAPSTQPASSPPEPLRSASPSKNSTNSPSPHPPAPAASSSCPTSTAN 222

Query: 471 ATATAPAPLAATRGPAAGTSSCVRTS 548
           A  T P P      PAA T+S   TS
Sbjct: 223 APPTCPTP------PAASTASPEPTS 242

 Score = 35.4 bits (80), Expect = 0.60
 Identities = 29/91 (31%), Positives = 45/91 (48%), Gaps = 6/91 (6%)
 Frame = +3

Query: 276 AAAPTAGVQRRASTRSWPRS-TPSPTCAS----CTSPPRTSPRSRWASPASTATWSAPAM 440
           ++ PT G     S  + P+   PSPT A+     T+ P  +P     SP+ +A  SAP  
Sbjct: 40  SSCPTTG-----SPNALPKPPNPSPTAATPPAPATTTPPPTPTGPTCSPSPSAANSAP-- 92

Query: 441 RSSCVPPTTAATATAP-APLAATRGPAAGTS 530
           R S  PP ++A +  P +P + +  PA  T+
Sbjct: 93  RESPPPPKSSAASPPPNSPPSTSSAPAPATT 123

 Score = 35.0 bits (79), Expect = 0.78
 Identities = 20/65 (30%), Positives = 29/65 (43%), Gaps = 2/65 (3%)
 Frame = +3

Query: 327 PRSTPSPTCASC--TSPPRTSPRSRWASPASTATWSAPAMRSSCVPPTTAATATAPAPLA 500
           P + P P  +SC  T  P   P+    SP +    + PA  ++  PPT      +P+P A
Sbjct: 31  PTTPPEPKASSCPTTGSPNALPKPPNPSPTAA---TPPAPATTTPPPTPTGPTCSPSPSA 87

Query: 501 ATRGP 515
           A   P
Sbjct: 88  ANSAP 92

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 28/91 (30%), Positives = 42/91 (45%), Gaps = 10/91 (10%)
 Frame = +3

Query: 279 AAPTAGVQRRASTRSWPRSTPSPT--------CASCTSPPRTSPRSRWASPA--STATWS 428
           A PT      AST S   ++P PT        C++ +  P T P S   SP+  S+++ +
Sbjct: 223 APPTCPTPPAASTASPEPTSPPPTWPAPSSKACSAASLTPST-PSSTKVSPSTVSSSSAA 281

Query: 429 APAMRSSCVPPTTAATATAPAPLAATRGPAA 521
           APA   S   P  ++ A +P+   A   P A
Sbjct: 282 APAPPQSAPSPPKSSAAPSPSQPKANTSPTA 312

 Score = 31.6 bits (70), Expect = 8.6
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 1/92 (1%)
 Frame = +3

Query: 276 AAAPTAGVQRR-ASTRSWPRSTPSPTCASCTSPPRTSPRSRWASPASTATWSAPAMRSSC 452
           A++P++    + AS+   P  + SP+  S  SP    P    +S   T+T +AP    +C
Sbjct: 171 ASSPSSAPSTQPASSPPEPLRSASPSKNSTNSPSPHPPAPAASSSCPTSTANAP---PTC 227

Query: 453 VPPTTAATATAPAPLAATRGPAAGTSSCVRTS 548
             P  A+TA+          PA  + +C   S
Sbjct: 228 PTPPAASTASPEPTSPPPTWPAPSSKACSAAS 259

>ref|XP_128808.1| sine oculis-related homeobox 2 homolog [Mus musculus]
          Length = 251

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 30/91 (32%), Positives = 44/91 (47%), Gaps = 4/91 (4%)
 Frame = +3

Query: 285 PTAGVQRRASTRSW----PRSTPSPTCASCTSPPRTSPRSRWASPASTATWSAPAMRSSC 452
           P+ G    +ST+SW     R T +P+C+SC S  RT+ R R  +    A W++ A  +S 
Sbjct: 12  PSTGATSASSTKSWRATSSRRTTTPSCSSCGS-RRTTSRRRSCAAGRWAPWASTACGASS 70

Query: 453 VPPTTAATATAPAPLAATRGPAAGTSSCVRT 545
             P  + TA  PA  +  R  A   S  + T
Sbjct: 71  RCPAPSGTARRPATASRRRAAACCASGTLTT 101



EST assemble image


clone accession position
1 CM068d05_r AV391033 1 591
2 CL15e09_r AV393989 42 544




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research