KCC000273A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000273A_C01 KCC000273A_c01
gCTCGTTAGAGGCCGCAAAGACCTGACTGCAACACTCGCGACTCCCCGAACTTCTTTCGA
TATTTGGAGCAGCTCGGCCGCCATGCAAACAAAGTCTTTCAGCCCTCAACAGCAGCAGCG
GCGTGGGGTGTGCGGTAACGCCCACGCCCCTCGCCTGTCGCTTCGCCATGCACCGCGGAG
CTCTCGGTGCGCGCCCTGCCGCGTTGCCGCGCCCGAGGCGCCCACGACTGTCAGCGCGTC
GACGCTGAACACGAGCTTTGTGCAGGACAAGCAACAGTACGAGGCCCTCTACAAGCGCTC
CATTGAGGACCCGGCCGGCTTCTGGGCCGAGATCGCCGAGCAGTTCCACTGGGAGACCAA
GTGGGAGCGCGACCACATGCGCTACAACTTCGACGTGCGGGCCGGCCCCATCTCTGTGGA
GTGGTTCCGCGGCGCCACCACCAACATCGCCTACAACTGCCTGGACAGGCACGTGCTTGC
TGGCCGCGGCGACCAGACGTGCTTCATCTGGGAGGGCAACGACGTGGGCCGCGAGAAGAG
CATGACGTACGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000273A_C01 KCC000273A_c01
         (552 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_198504.1| acetyl-CoA synthetase (acetate-CoA ligase), put...   124  8e-28
gb|AAB92552.1| acetyl-CoA synthetase [Arabidopsis thaliana]           122  2e-27
emb|CAA67130.1| acetyl-CoA synthetase [Solanum tuberosum]             120  2e-26
emb|CAE02031.1| OSJNBb0118P14.22 [Oryza sativa (japonica cultiva...   114  7e-25
sp|Q9VP61|ACSA_DROME Acetyl-coenzyme A synthetase (Acetate--CoA ...   105  3e-22

>ref|NP_198504.1| acetyl-CoA synthetase (acetate-CoA ligase), putative [Arabidopsis
           thaliana] gi|8953708|dbj|BAA98066.1| acetyl-CoA
           synthetase [Arabidopsis thaliana]
           gi|15028047|gb|AAK76554.1| putative acetyl-CoA
           synthetase [Arabidopsis thaliana]
           gi|26983904|gb|AAN86204.1| putative acetyl-CoA
           synthetase [Arabidopsis thaliana]
          Length = 693

 Score =  124 bits (311), Expect = 8e-28
 Identities = 52/99 (52%), Positives = 71/99 (71%)
 Frame = +2

Query: 254 SFVQDKQQYEALYKRSIEDPAGFWAEIAEQFHWETKWERDHMRYNFDVRAGPISVEWFRG 433
           + V   QQY  ++KRS++DPA FW++IA +F+W+ KW       N DVR GPIS+EWF+G
Sbjct: 52  ALVSSPQQYMEMHKRSMDDPAAFWSDIASEFYWKQKWGDQVFSENLDVRKGPISIEWFKG 111

Query: 434 ATTNIAYNCLDRHVLAGRGDQTCFIWEGNDVGREKSMTY 550
             TNI YNCLD++V AG GD+T   WEGN++G + S+TY
Sbjct: 112 GITNICYNCLDKNVEAGLGDKTAIHWEGNELGVDASLTY 150

>gb|AAB92552.1| acetyl-CoA synthetase [Arabidopsis thaliana]
          Length = 693

 Score =  122 bits (307), Expect = 2e-27
 Identities = 51/99 (51%), Positives = 70/99 (70%)
 Frame = +2

Query: 254 SFVQDKQQYEALYKRSIEDPAGFWAEIAEQFHWETKWERDHMRYNFDVRAGPISVEWFRG 433
           + V   QQY  ++KRS++DPA FW++IA +F+W+ KW       N DVR GPIS+EWF+G
Sbjct: 52  ALVSSPQQYMEMHKRSMDDPAAFWSDIASEFYWKQKWGDQVFSENLDVRKGPISIEWFKG 111

Query: 434 ATTNIAYNCLDRHVLAGRGDQTCFIWEGNDVGREKSMTY 550
             TNI YNCLD++V  G GD+T   WEGN++G + S+TY
Sbjct: 112 GITNICYNCLDKNVEXGLGDKTAIHWEGNELGVDASLTY 150

>emb|CAA67130.1| acetyl-CoA synthetase [Solanum tuberosum]
          Length = 631

 Score =  120 bits (300), Expect = 2e-26
 Identities = 47/88 (53%), Positives = 65/88 (73%)
 Frame = +2

Query: 287 LYKRSIEDPAGFWAEIAEQFHWETKWERDHMRYNFDVRAGPISVEWFRGATTNIAYNCLD 466
           +Y+RS+ DP+GFW++IA +F+W  KW +     NFDVR G I +EWF+G  TNI YNCLD
Sbjct: 1   MYQRSVHDPSGFWSDIASEFYWREKWGQQVYHENFDVRKGKIKIEWFKGGMTNICYNCLD 60

Query: 467 RHVLAGRGDQTCFIWEGNDVGREKSMTY 550
           R++ +G+GD+T   WEGN+ G + SMTY
Sbjct: 61  RNIESGKGDKTAIYWEGNEPGLDSSMTY 88

>emb|CAE02031.1| OSJNBb0118P14.22 [Oryza sativa (japonica cultivar-group)]
           gi|32487908|emb|CAE05367.1| OJ000315_02.12 [Oryza sativa
           (japonica cultivar-group)]
          Length = 771

 Score =  114 bits (286), Expect = 7e-25
 Identities = 48/92 (52%), Positives = 66/92 (71%), Gaps = 1/92 (1%)
 Frame = +2

Query: 278 YEALYKRSIEDPAGFWAEIAEQFHWETKWERDHM-RYNFDVRAGPISVEWFRGATTNIAY 454
           Y+ +Y+RSI+DPAGFW+EIAE F+W+ KW  D +   N DV  GPI +EWF+G  TNI Y
Sbjct: 182 YQEMYRRSIDDPAGFWSEIAETFYWKHKWNPDEVCTENLDVTKGPIKIEWFKGGKTNICY 241

Query: 455 NCLDRHVLAGRGDQTCFIWEGNDVGREKSMTY 550
           N +DR+V AG G++    WEGN+ G++  +TY
Sbjct: 242 NAVDRNVEAGDGEKIAMYWEGNEPGQDAKLTY 273

>sp|Q9VP61|ACSA_DROME Acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating
           enzyme) (Acetyl-CoA synthetase) (ACS) (AceCS)
           gi|19528327|gb|AAL90278.1| LD12826p [Drosophila
           melanogaster]
          Length = 670

 Score =  105 bits (263), Expect = 3e-22
 Identities = 41/90 (45%), Positives = 66/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query: 254 SFVQDKQQYEALYKRSIEDPAGFWAEIAEQFHWETKWERDH-MRYNFDVRAGPISVEWFR 430
           +++   ++Y+  Y+ S+++PA FW+ +A+QFHWET  ++D  ++YNF++  GPIS++W  
Sbjct: 18  AYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISKGPISIKWME 77

Query: 431 GATTNIAYNCLDRHVLAGRGDQTCFIWEGN 520
           GA+TN+ YN LDR+V  G GDQ  + WEGN
Sbjct: 78  GASTNLCYNLLDRNVRNGLGDQIAYYWEGN 107



EST assemble image


clone accession position
1 HCL007c07_r AV639923 1 310
2 CL15e02_r AV393970 2 515
3 MXL019c06_r BP094184 9 534
4 HCL021g11_r AV640751 9 359
5 HCL012a01_r AV640197 15 258
6 MXL094a05_r BP098482 16 395
7 HCL041e11_r AV641866 29 477
8 HCL069h12_r AV643455 30 529
9 HCL028b09_r AV641126 30 552
10 HCL012f01_r AV640229 107 276




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research