KCC000269A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000269A_C01 KCC000269A_c01
gcataacatactTATCAGGATACGCCCCCAGCCCTCGCGAAACAAACTCTATCGCCCCTC
CACTGAGACCGACAACCATGTGCTTCCAGACGACGTGCGCCTCTTGCAAGAAGCCCACCT
GGTCAGGCTGTGGCAAGCATATCGATTCGGCTCTGGCCTCCGTCAAGCTCGACGACCGGT
GCCCTTGCAAAGCACGAACCCAGGCGGAGCAGGATGCCGAGACACGCTGAGACCCTGACG
CATGCGCCGTGCTGGTGCTTCCGAGGGAAGCCATGTGTTCCTGAGCATGAGCGATAAGCT
ATGCAGAGTTGGGTAGTAGCACGCTGCGGTGGTCTTCAGGCCCTGCTGTCGTGCGTGCCC
CACTGCTGATGTTGAGTTTGGGGCGTCACCTCGGAGATGTTTCGCTTATGTTTGTGTTTT
GCATAAAGTTTTGATCTTCCCGCTGCAATGCGGGCCGAGTCAGTTTTCATTATTATAGCA
TAAACCGGGTGCCCCTTCAACTGGCAAGTCGACGTTAGGTACCCGGCTTGTGATACCGCA
CATCTGCGTATCCCGCTTGTAACACACCAGTGACAAAAAAAAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000269A_C01 KCC000269A_c01
         (583 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_322451.1| predicted protein [Neurospora crassa] gi|289189...    48  9e-05
ref|NP_600530.1| hypothetical protein [Corynebacterium glutamicu...    46  4e-04
ref|NP_718007.1| iron-sulfur cluster-binding protein [Shewanella...    35  1.00
ref|NP_630289.1| putative phosphoheptose isomerase [Streptomyces...    34  1.7
ref|NP_198180.2| sterol desaturase domain-containing protein [Ar...    33  2.2

>ref|XP_322451.1| predicted protein [Neurospora crassa] gi|28918931|gb|EAA28600.1|
           predicted protein [Neurospora crassa]
          Length = 65

 Score = 48.1 bits (113), Expect = 9e-05
 Identities = 17/42 (40%), Positives = 22/42 (51%)
 Frame = +3

Query: 78  MCFQTTCASCKKPTWSGCGKHIDSALASVKLDDRCPCKARTQ 203
           MC   TC +C K  W GCG H+ S  A V  D  C C+ + +
Sbjct: 1   MCMSATCPTCSKQAWRGCGSHVPSVFAGVPEDKWCTCEPKVE 42

>ref|NP_600530.1| hypothetical protein [Corynebacterium glutamicum ATCC 13032]
           gi|21324077|dbj|BAB98702.1| Hypothetical protein
           [Corynebacterium glutamicum ATCC 13032]
          Length = 52

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 16/35 (45%), Positives = 21/35 (59%)
 Frame = +3

Query: 78  MCFQTTCASCKKPTWSGCGKHIDSALASVKLDDRC 182
           MC   TC  C K TW+GCG+H+D  + +V    RC
Sbjct: 1   MCRAVTCKKCGKTTWAGCGQHVDQVMKNVPSSQRC 35

>ref|NP_718007.1| iron-sulfur cluster-binding protein [Shewanella oneidensis MR-1]
           gi|24348406|gb|AAN55451.1|AE015682_6 iron-sulfur
           cluster-binding protein [Shewanella oneidensis MR-1]
          Length = 144

 Score = 34.7 bits (78), Expect = 1.00
 Identities = 21/71 (29%), Positives = 31/71 (43%)
 Frame = +3

Query: 54  APPLRPTTMCFQTTCASCKKPTWSGCGKHIDSALASVKLDDRCPCKARTQAEQDAETR*D 233
           A  +R  + C    C +CK    SG   ++   LA +K D+  PC       +D E    
Sbjct: 45  AKKVRIFSECRSGFCGACKTKVLSGSVTYLTEPLAKLKADECLPCCC--IPSEDLELDLS 102

Query: 234 PDACAVLVLPR 266
           P+  AV+  PR
Sbjct: 103 PEGAAVVAYPR 113

>ref|NP_630289.1| putative phosphoheptose isomerase [Streptomyces coelicolor A3(2)]
           gi|7387844|sp|Q9Z5B6|LPCA_STRCO Phosphoheptose isomerase
           gi|7481181|pir||T34840 probable phosphoheptose isomerase
           - Streptomyces coelicolor gi|4455731|emb|CAB36594.1|
           putative phosphoheptose isomerase [Streptomyces
           coelicolor A3(2)]
          Length = 231

 Score = 33.9 bits (76), Expect = 1.7
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 2/81 (2%)
 Frame = -1

Query: 259 STSTAHASGSQRVSASCSAWVR--ALQGHRSSSLTEARAESICLPQPDQVGFLQEAHVVW 86
           STS A A+      A+ +A VR  AL G   + L     ES+C+  P     +QE H+V 
Sbjct: 118 STSGASANLLSAADAARAAGVRVWALTGRAPNPLMAGSDESLCVEAPS-TATVQEIHLVA 176

Query: 85  KHMVVGLSGGAIEFVSRGLGA 23
            HM+      A+E    G  A
Sbjct: 177 VHMICAAFDAALERGEHGARA 197

>ref|NP_198180.2| sterol desaturase domain-containing protein [Arabidopsis thaliana]
          Length = 339

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = +3

Query: 15  SGYAPSPRETNSIAPPLRPTTMC-FQTTCASCKKPT 119
           S  A  PR T SI   L PTT+C FQ+T  S  +PT
Sbjct: 234 SSSATPPRSTRSITRNLEPTTLCSFQSTTISTGRPT 269



EST assemble image


clone accession position
1 MXL008c05_r BP093427 1 218
2 CL15a05_r AV393980 13 515
3 CL42g07_r AV395506 25 464
4 CL21e03_r AV394341 70 584




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research