KCC000267A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000267A_C01 KCC000267A_c01
ctgttcggccagcaggagggttcagagatcatgaataccattagaatcggtgcgctagtg
gacacgccgctcaacttcgcCGCAAAAAGCCTGGGCCTGCCCTTTCGGTTTGACCGCAAC
ACCGCGGACAAGTCAGGCGCAACAGCACGGCGGCTTCGCCCGGACTTCCTCTTTTGGATG
CGGAACATCCTACTCTTCAAGGGGGTGGAGAAGGCAGCCTCCGACGAGCACGAGACTGCG
GTTGCGGAGTTAAAATCCAAGATGGCGACCTCGTGGAACCCCGCCCTGCTGCCGGGCGTC
AGCATGCCATGCATGTTCGCCTACGCAGCCGCTGGCAGCCAGGTGCAGTTCTTTGCAGTC
ACGAGCCGCGACGGTGCGGTGGAGGCGACTCCCGTCAGCGACTGCCTGCACATCAACACA
CCGCTCGGCCGCATCAAGGTCGTGCACCACACTCTCAAGGTCCTGCAAGCGGTGGCGGCT
TACGCGCCCAGTGCGCCAAACCTCTCCATCGCCCTTGGGCAGGTGTCCAAGGCGTTGACG
CTCAACGGCAGCTTCCTGAGCAGTGTGACTGTGTTCCCGGACTTCATCCGGAAGCGCGTC
GACCTTTCACAGATGCAGGGTGGCGTTCTGGATCACAGGGCGCTGGTGGCCATGTACCGC
GCCATTGGTCAGGTGCGCTGCCTCAACCTGGTGCGCCTTCGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000267A_C01 KCC000267A_c01
         (703 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAN07178.1| Crip-31 [Clerodendrum inerme]                           50  4e-05
pir||A61183 hypothetical protein (sdsB region) - Pseudomonas sp        48  1e-04
ref|ZP_00141778.1| COG0028: Thiamine pyrophosphate-requiring enz...    44  0.003
ref|NP_295856.1| conserved hypothetical protein [Deinococcus rad...    42  0.012
gb|AAF06353.1|AF199413_1 thymidine kinase [Pseudorabies virus]         40  0.027

>gb|AAN07178.1| Crip-31 [Clerodendrum inerme]
          Length = 290

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 38/114 (33%), Positives = 59/114 (51%), Gaps = 6/114 (5%)
 Frame = +2

Query: 233 RLRLRS*NPRWRPRGTPPCCRASACHA--CSPTQPLAARCSSLQSRAATV---RWRRLPS 397
           R  LRS + + RPR   P CR+S+  +  C+P+ P +  CS  +  +++    RW R P+
Sbjct: 154 RKNLRSISLQRRPRPASPACRSSSASSSSCTPSSPRSPACSPRRRPSSSSWPSRWPRPPA 213

Query: 398 ATACTSTHRSAASRSCTTLSRSCKRWRLTRPVRQTSP-SPLGRCPRR*RSTAAS 556
           +T+ T    S ASR+         R   +RP  ++ P SP   C R  RS+A+S
Sbjct: 214 STSRTYRPTSTASRT--------TRCSTSRPGARSPPRSPRTACSRSRRSSASS 259

>pir||A61183 hypothetical protein (sdsB region) - Pseudomonas sp
          Length = 312

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 67/218 (30%), Positives = 77/218 (34%), Gaps = 30/218 (13%)
 Frame = +3

Query: 114 PQHRGQVRRNSTAASPGLPLLDAEHPTLQGGGEGSLRRARDCGCGVKIQDGDLVEPRPAA 293
           PQH G   R      PGLP      P   G   G   R R  G G +        P PA 
Sbjct: 39  PQHPGPGER------PGLP------PAGPGAAPGEPDRPRPAGAGTR--------PAPAG 78

Query: 294 GRQHAMHVRLRSRWQPG----AVLCSHEPRRC----GGGDSRQRLP------AHQHTARP 431
            R  A    L +  QPG    A  C   PRR     G G  R+  P       H+H  +P
Sbjct: 79  RRPRAAQCGLPAG-QPGQRRTAPGCRPLPRRPPGAPGAGALRRGTPRGAGAIGHRHLVQP 137

Query: 432 HQ---GRAPHS---------QGPASGGGLRAQCAK----PLHRPWAGVQGVDAQRQLPEQ 563
                GR P +         + PA+GG   AQ A+    P   P AG     A    P  
Sbjct: 138 APAPAGRCPGAVRGRCAGTARRPAAGGHAAAQLARGDFLPTGAPAAGPAPAPADGGRPGS 197

Query: 564 CDCVPGLHPEARRPFTDAGWRSGSQGAGGHVPRHWSGA 677
                G HP ARR     G   G + A GH  R   GA
Sbjct: 198 LPA--GRHPGARRGGAGPGAVGGKRPAAGHRMRQLHGA 233

>ref|ZP_00141778.1| COG0028: Thiamine pyrophosphate-requiring enzymes [acetolactate
           synthase, pyruvate dehydrogenase (cytochrome),
           glyoxylate carboligase, phosphonopyruvate decarboxylase]
           [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 592

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 54/176 (30%), Positives = 61/176 (33%), Gaps = 7/176 (3%)
 Frame = +3

Query: 156 SPGLPLLDAEHPTLQGGGEGSLRRARDCGCGVKI----QDGDLVEPRPAAGRQHAMHVRL 323
           +PG P      P  Q G    + R R  G G+ +    Q      P     R H      
Sbjct: 361 APGQPA----RPARQRGRP--VHRRRRLGDGLAVASHPQQRQAPHPHQPGPRHHGQ---- 410

Query: 324 RSRWQPGAVLCSHEPRRCGGGDSRQRLPAHQHTARPHQGRAPHSQGPASGGGLRAQCAKP 503
             R  PGA      PR  G  D R+R P H    RP  G   H    A  G    QC   
Sbjct: 411 --RHAPGAGTEEGLPRAPGDLDLRRRRPGHA-ARRPADG---HPGKTADQGSGAEQCLAE 464

Query: 504 LHRPWAGVQGVDAQRQLPEQCDCVPGLHPEA---RRPFTDAGWRSGSQGAGGHVPR 662
           L R     +G   Q   P Q    PGL P     R P T      GS+G G  VPR
Sbjct: 465 LRRAGTEGRGPAGQLHRPAQ----PGLRPARRGDRLPRTQGDALRGSRGGGAGVPR 516

>ref|NP_295856.1| conserved hypothetical protein [Deinococcus radiodurans]
           gi|7471338|pir||B75310 conserved hypothetical protein -
           Deinococcus radiodurans  (strain R1)
           gi|6459930|gb|AAF11681.1|AE002048_1 conserved
           hypothetical protein [Deinococcus radiodurans]
          Length = 528

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 45/167 (26%), Positives = 65/167 (37%), Gaps = 25/167 (14%)
 Frame = +2

Query: 131 SQAQQHGGFARTSSFGCGTSYSSRGWRRQP---PTSTRLRLRS*NPRWRPRGTPPCCRAS 301
           +QA +     R  +F C  S   RG R++P   P+S   R R    R  P G  P    +
Sbjct: 325 AQAHRPSSARRPCAFRCRRSKPRRGRRQRPVTRPSSHVTRRRRPATRPSPSGRRPSTPVT 384

Query: 302 ----ACHACSPTQPLAARCSSLQSRAATVRWRRLPSATACTSTHRSAASRSCTTLSRSCK 469
               +   C  + P   R ++ + R AT   R  P     + + R+A  RS  T  R  +
Sbjct: 385 GWWPSATGCRLSAPRRCRRATKRCRTATGCGRTSPRCGPSSGSCRAATRRSPRTSPRRAR 444

Query: 470 RWRLTRPV------------------RQTSPSPLGRCPRR*RSTAAS 556
             R +RP                   R+T+ S  G CPR   ST +S
Sbjct: 445 ASRASRPTIPAPAANSASAAPPNSPTRKTNWSTPGWCPRSAASTPSS 491

>gb|AAF06353.1|AF199413_1 thymidine kinase [Pseudorabies virus]
          Length = 297

 Score = 40.4 bits (93), Expect = 0.027
 Identities = 51/156 (32%), Positives = 65/156 (40%), Gaps = 11/156 (7%)
 Frame = +2

Query: 257 PRWRPRGTPPCCRASACHACSPTQPLAARCSSLQSRA---ATVRW--RRLP----SATAC 409
           PRW         R S C AC+P +   +  +   SRA   +T  W  RR      +A A 
Sbjct: 152 PRWT--------RTSTCGACAPARAPGSTWTRACSRACATSTPCWSTRRATLARGAAGAT 203

Query: 410 TSTHRSAASRSCTTLSRSCKRWRLTRPVRQTSPSPLGRCPRR*RSTAAS*AV*LCSRTSS 589
           T   R A++R C T SRS      +   R T+PS   R P   R+   S      S T +
Sbjct: 204 TGGARRASTRPCATASRS-----TSSAARATAPS--SRTPSSARTRRPS------SATGA 250

Query: 590 GSASTFHRCRVAFWITGRWWPCTAPLVRCAA--STW 691
           G+ S   RC    W   R WP      RCA+  STW
Sbjct: 251 GARS---RCTRGRWT--RSWPSCC---RCASPPSTW 278



EST assemble image


clone accession position
1 CL14h06_r AV393882 1 524
2 HCL031h12_r AV641343 187 703
3 MXL048g03_r BP095882 231 617




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research