KCC000266A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000266A_C01 KCC000266A_c01
ccttttgacccggtgagggagcTTTACTTTCACTCCCGACCGGACCTTGCGGCTTTCTTT
AGGTCCTCGCCGCCGACGGTCTCGCGGTGTGCTTCAGCATTTTCACACATCAATCTCCTG
CCATACCCTACCTCCTTTTTAGCTCGGACCTCTAAGTAGAGCAGCGCCAAGATGGCGCCC
AAGAAGGAGGACCGCAAGGGCGGCGAGGAGACCCTCACGCGTATTGCCATCGTCAGCGAG
GACAAGTGCAAGCCCAAGAAGTGTCGTCAGGAGTGCAAGAAGAGCTGCCCCGTCGTCAAA
GTCGGCAAGCTCTGTATTGAGGTCGCGCCGAACTCCAAGATTGCATGGATTTCCGAGGAG
CTGTGCATCGGTTGCGGTATCTGCGTGAAGAAATGCCCGTTCGAGGCGATCATGATCATC
AACCTGCCCAAGGACCTCGAAAAGGAGACCACGCACCGCTACGGCCCCAACACCTTCAAG
CTGCACAGGCTGCCCATGCCTCGCCCCGGCCAGGTGCTGGGCCTGGTGGGCACCAACGGC
ATCGGCAAGTCCACGGCGCTCAAGGTGCTGGCGGGCAAGCTCAAGCCCAACCTGTGCCGC
TTCACGAACCCGCCTGAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000266A_C01 KCC000266A_c01
         (618 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM19067.1| RNase L inhibitor-like protein [Oryza sativa (jap...   263  2e-69
gb|AAL26702.1| 68 kDa protein HP68 [Triticum aestivum]                261  7e-69
ref|NP_193656.2| RNase L inhibitor protein, putative [Arabidopsi...   254  9e-67
pir||T04442 ABC-type transport protein T18B16.180 - Arabidopsis ...   254  9e-67
ref|NP_187973.1| RNase L inhibitor protein, putative [Arabidopsi...   248  4e-65

>gb|AAM19067.1| RNase L inhibitor-like protein [Oryza sativa (japonica
           cultivar-group)]
          Length = 604

 Score =  263 bits (672), Expect = 2e-69
 Identities = 125/137 (91%), Positives = 130/137 (94%)
 Frame = +1

Query: 208 ETLTRIAIVSEDKCKPKKCRQECKKSCPVVKVGKLCIEVAPNSKIAWISEELCIGCGICV 387
           E LTRIAIVSEDKCKPKKCRQECKKSCPVVK GKLCIEV P SK+A+ISEELCIGCGICV
Sbjct: 3   ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCIGCGICV 62

Query: 388 KKCPFEAIMIINLPKDLEKETTHRYGPNTFKLHRLPMPRPGQVLGLVGTNGIGKSTALKV 567
           KKCPF+AI IINLPKDLEK+TTHRYGPNTFKLHRLP+PRPGQVLGLVGTNGIGKSTALKV
Sbjct: 63  KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV 122

Query: 568 LAGKLKPNLCRFTNPPD 618
           LAGKLKPNL RF NPPD
Sbjct: 123 LAGKLKPNLGRFKNPPD 139

 Score = 33.1 bits (74), Expect = 3.3
 Identities = 13/27 (48%), Positives = 22/27 (81%)
 Frame = +1

Query: 511 QVLGLVGTNGIGKSTALKVLAGKLKPN 591
           Q++ ++G NG GK+T +++LAG LKP+
Sbjct: 374 QIVVMLGENGTGKTTFIRMLAGLLKPD 400

>gb|AAL26702.1| 68 kDa protein HP68 [Triticum aestivum]
          Length = 604

 Score =  261 bits (666), Expect = 7e-69
 Identities = 123/137 (89%), Positives = 131/137 (94%)
 Frame = +1

Query: 208 ETLTRIAIVSEDKCKPKKCRQECKKSCPVVKVGKLCIEVAPNSKIAWISEELCIGCGICV 387
           + LTRIAIVSEDKCKPKKCRQECKKSCPVVK GKLCIEV+P +K+A+ISEELCIGCGICV
Sbjct: 3   DRLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPVAKLAFISEELCIGCGICV 62

Query: 388 KKCPFEAIMIINLPKDLEKETTHRYGPNTFKLHRLPMPRPGQVLGLVGTNGIGKSTALKV 567
           KKCPF+AI IINLPKDLEK+TTHRYGPNTFKLHRLP+PRPGQVLGLVGTNGIGKSTALKV
Sbjct: 63  KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV 122

Query: 568 LAGKLKPNLCRFTNPPD 618
           LAGKLKPNL RF NPPD
Sbjct: 123 LAGKLKPNLGRFKNPPD 139

 Score = 33.1 bits (74), Expect = 3.3
 Identities = 13/27 (48%), Positives = 22/27 (81%)
 Frame = +1

Query: 511 QVLGLVGTNGIGKSTALKVLAGKLKPN 591
           Q++ ++G NG GK+T +++LAG LKP+
Sbjct: 374 QIVVMLGENGTGKTTFIRMLAGLLKPD 400

>ref|NP_193656.2| RNase L inhibitor protein, putative [Arabidopsis thaliana]
           gi|20466462|gb|AAM20548.1| RNase L inhibitor-like
           protein [Arabidopsis thaliana]
           gi|23198180|gb|AAN15617.1| RNase L inhibitor-like
           protein [Arabidopsis thaliana]
          Length = 605

 Score =  254 bits (648), Expect = 9e-67
 Identities = 119/137 (86%), Positives = 128/137 (92%)
 Frame = +1

Query: 208 ETLTRIAIVSEDKCKPKKCRQECKKSCPVVKVGKLCIEVAPNSKIAWISEELCIGCGICV 387
           + LTRIAIVS D+CKPKKCRQECKKSCPVVK GKLCIEV   SK+A+ISEELCIGCGICV
Sbjct: 3   DRLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCGICV 62

Query: 388 KKCPFEAIMIINLPKDLEKETTHRYGPNTFKLHRLPMPRPGQVLGLVGTNGIGKSTALKV 567
           KKCPFEAI IINLP+DLEK+TTHRYG NTFKLHRLP+PRPGQVLGLVGTNGIGKSTALK+
Sbjct: 63  KKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKI 122

Query: 568 LAGKLKPNLCRFTNPPD 618
           LAGKLKPNL RFT+PPD
Sbjct: 123 LAGKLKPNLGRFTSPPD 139

 Score = 33.5 bits (75), Expect = 2.5
 Identities = 13/27 (48%), Positives = 22/27 (81%)
 Frame = +1

Query: 511 QVLGLVGTNGIGKSTALKVLAGKLKPN 591
           Q++ ++G NG GK+T +++LAG LKP+
Sbjct: 375 QIIVMLGENGTGKTTFIRMLAGLLKPD 401

>pir||T04442 ABC-type transport protein T18B16.180 - Arabidopsis thaliana
           gi|2828296|emb|CAA16710.1| RNase L inhibitor-like
           protein [Arabidopsis thaliana]
           gi|7268716|emb|CAB78923.1| RNase L inhibitor-like
           protein [Arabidopsis thaliana]
          Length = 600

 Score =  254 bits (648), Expect = 9e-67
 Identities = 119/137 (86%), Positives = 128/137 (92%)
 Frame = +1

Query: 208 ETLTRIAIVSEDKCKPKKCRQECKKSCPVVKVGKLCIEVAPNSKIAWISEELCIGCGICV 387
           + LTRIAIVS D+CKPKKCRQECKKSCPVVK GKLCIEV   SK+A+ISEELCIGCGICV
Sbjct: 3   DRLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCGICV 62

Query: 388 KKCPFEAIMIINLPKDLEKETTHRYGPNTFKLHRLPMPRPGQVLGLVGTNGIGKSTALKV 567
           KKCPFEAI IINLP+DLEK+TTHRYG NTFKLHRLP+PRPGQVLGLVGTNGIGKSTALK+
Sbjct: 63  KKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKI 122

Query: 568 LAGKLKPNLCRFTNPPD 618
           LAGKLKPNL RFT+PPD
Sbjct: 123 LAGKLKPNLGRFTSPPD 139

>ref|NP_187973.1| RNase L inhibitor protein, putative [Arabidopsis thaliana]
           gi|9294008|dbj|BAB01911.1| RNase L inhibitor
           [Arabidopsis thaliana] gi|28393118|gb|AAO41992.1|
           putative RNase L inhibitor protein [Arabidopsis
           thaliana] gi|28827462|gb|AAO50575.1| putative RNase L
           inhibitor protein [Arabidopsis thaliana]
          Length = 603

 Score =  248 bits (634), Expect = 4e-65
 Identities = 118/137 (86%), Positives = 124/137 (90%)
 Frame = +1

Query: 208 ETLTRIAIVSEDKCKPKKCRQECKKSCPVVKVGKLCIEVAPNSKIAWISEELCIGCGICV 387
           + LTRIAIVSED+CKPKKCRQECKKSCPVVK GKLCIEV   SK A+ISEELCIGCGICV
Sbjct: 3   DRLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGKLCIEVGSTSKSAFISEELCIGCGICV 62

Query: 388 KKCPFEAIMIINLPKDLEKETTHRYGPNTFKLHRLPMPRPGQVLGLVGTNGIGKSTALKV 567
           KKCPFEAI IINLPKDL K+TTHRYG N FKLHRLP+PRPGQVLGLVGTNGIGKSTALK+
Sbjct: 63  KKCPFEAIQIINLPKDLAKDTTHRYGANGFKLHRLPIPRPGQVLGLVGTNGIGKSTALKI 122

Query: 568 LAGKLKPNLCRFTNPPD 618
           LAGKLKPNL RF  PPD
Sbjct: 123 LAGKLKPNLGRFNTPPD 139



EST assemble image


clone accession position
1 HCL087f11_r AV644391 1 586
2 HCL026b03_r AV641007 68 575
3 CL71a01_r AV396868 83 686
4 LCL049c03_r AV628937 84 273
5 HCL072e12_r AV643604 84 560
6 CL14h03_r AV393865 84 464
7 HCL096g03_r AV644995 90 407
8 HCL084h07_r AV644260 98 598
9 CL67e11_r AV396720 98 545
10 HCL007g10_r AV639951 189 618




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research