KCC000265A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000265A_C01 KCC000265A_c01
cttgacaacatgCGCTGATCAGGTCGCTATTGCCTTAGGTTCAACTGTACTTCACAATAC
CCTTGTGAGCTGTTTCCTAGTCGACTTGTCAGTCAGGCCTTATATCAGTCGTTGGCCGCC
GCACGATGGGCTGCGGCTCGTCAGTTCCGAGTTCGCATCCGCAGCAGGTGTTGCCCGGAC
CCAACCCTGTGAGCGCCCAGGAGGGCATCTCGAAGCATGAAGTCCAGAGTCAGGCACCGC
AGCAGTATGAACTGCCGCCCGCCCCCGCGGCAGGCCCTGCCGCACCGCAACAGCAGGCAG
TAGGTGCCCCTCAGTATGTCCAACAAGGTTATGTGGCGCCGCAGCATGTGGCTCCTGCCG
AACCACAGCAGGCGGTCCCTCAGCAGCACATTCAAGCGCCTGTGCCCGCCACGCCCGCAC
CAGCAGCTACAGTGCCGCAGCAGCAGCCGGTGCCGCAACCAGTCGTGCAACCAGCAATGG
TGGCCCCTGTTACACAAGCGGCGTCGCCGCAGCAGACGCAGGAAGATAGTTTCTTTCCCT
CCGCCGCGACAACGGTGATGTCGTTTGGCGCGCTGCCCGAGACCCTCCAAGACCTGCATG
ACGGCATGCCATCCGAGATCGCCGACGCGCCCATGCGCCTCCTCATGATCGACGCAGTGC
TGCGCTGGACCACGATTGCGGTGTATGAGGACGTGCAGCCGGGCGAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000265A_C01 KCC000265A_c01
         (707 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAC10624.1| gamma-gliadin [Aegilops speltoides]                    65  1e-09
emb|CAC10616.1| gamma-gliadin [Aegilops longissima]                    64  3e-09
emb|CAC10593.1| gamma-gliadin [Aegilops bicornis] gi|10635144|em...    64  3e-09
emb|CAC10623.1| gamma-gliadin [Aegilops speltoides]                    64  3e-09
gb|AAG35598.1|AF201084_1 secalin precursor [Secale cereale]            63  5e-09

>emb|CAC10624.1| gamma-gliadin [Aegilops speltoides]
          Length = 256

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 46/126 (36%), Positives = 54/126 (42%), Gaps = 4/126 (3%)
 Frame = +3

Query: 216 HEVQSQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQGYVAPQHVAPAEPQQAVPQQHIQ 395
           H+  SQ PQQ  +P      P   QQQ    PQ  QQ ++ PQ   P +PQQ  PQQ  Q
Sbjct: 1   HQPFSQQPQQ-TVPQPQQTFPHQQQQQQFPQPQQPQQQFLQPQQPFPQQPQQPYPQQP-Q 58

Query: 396 APVPATPAPAATVPQ----QQPVPQPVVQPAMVAPVTQAASPQQTQEDSFFPSAATTVMS 563
            P P T  P    PQ    QQP PQ   QP    P  Q   PQ  Q    FP +      
Sbjct: 59  QPFPQTQQPQQLFPQSQQPQQPYPQQPQQPYPQQP--QQPFPQTQQPQQLFPQSQQPQQP 116

Query: 564 FGALPE 581
           +   P+
Sbjct: 117 YPQQPQ 122

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 51/156 (32%), Positives = 56/156 (35%), Gaps = 17/156 (10%)
 Frame = +3

Query: 150 SSHPQQVLPGPNPVSAQEGISKHEVQSQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQG 329
           S  PQQ +P P      +   +   Q Q PQQ  L P        PQQ     PQ  QQ 
Sbjct: 5   SQQPQQTVPQPQQTFPHQQQQQQFPQPQQPQQQFLQPQ----QPFPQQPQQPYPQQPQQP 60

Query: 330 Y-------------VAPQHVAPAEPQQAVPQQHIQAPVPATPAPAATVPQ----QQPVPQ 458
           +               PQ   P +PQQ  PQQ  Q P P T  P    PQ    QQP PQ
Sbjct: 61  FPQTQQPQQLFPQSQQPQQPYPQQPQQPYPQQP-QQPFPQTQQPQQLFPQSQQPQQPYPQ 119

Query: 459 PVVQPAMVAPVTQAASPQQTQEDSFFPSAATTVMSF 566
              QP       Q   PQ  Q    FP       SF
Sbjct: 120 QPQQPFPQTQQPQQQFPQYQQPQQQFPQPQQPQQSF 155

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 43/131 (32%), Positives = 50/131 (37%), Gaps = 18/131 (13%)
 Frame = +3

Query: 159 PQQVLPG----PNPVSAQEGISKHEVQSQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQ 326
           PQQ  P     P P   Q+   + +   Q   Q + P  P   P  PQQ     PQ    
Sbjct: 41  PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQPY--PQQPQQPYPQQPQQPFP 98

Query: 327 GYVAPQHVAPA--EPQQAVPQQHIQAPVPATPAPAATVPQQQ------PVPQ------PV 464
               PQ + P   +PQQ  PQQ  Q P P T  P    PQ Q      P PQ      P 
Sbjct: 99  QTQQPQQLFPQSQQPQQPYPQQP-QQPFPQTQQPQQQFPQYQQPQQQFPQPQQPQQSFPQ 157

Query: 465 VQPAMVAPVTQ 497
            QP+ V P  Q
Sbjct: 158 QQPSFVQPSLQ 168

>emb|CAC10616.1| gamma-gliadin [Aegilops longissima]
          Length = 300

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 46/117 (39%), Positives = 50/117 (42%), Gaps = 4/117 (3%)
 Frame = +3

Query: 228 SQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQGYVAPQHVAPAEPQQAVPQQHIQAPVP 407
           SQ PQQ   P      P  PQQQ +  PQ  QQ ++ PQ   P +PQQ  PQQ  Q P P
Sbjct: 29  SQQPQQ-TFPQPQQTFPHQPQQQ-IPQPQQPQQQFLQPQQPFPQQPQQPYPQQP-QQPFP 85

Query: 408 ATPAPAATVPQ----QQPVPQPVVQPAMVAPVTQAASPQQTQEDSFFPSAATTVMSF 566
            T  P    PQ    QQP PQ   QP       Q   PQ  Q    FP       SF
Sbjct: 86  QTQQPQQLFPQSQQPQQPYPQQPQQPFPQTQQPQQQFPQSQQPQQPFPQPQQPQQSF 142

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 39/125 (31%), Positives = 45/125 (35%), Gaps = 3/125 (2%)
 Frame = +3

Query: 150 SSHPQQVLPGPNPVSAQEGISKHEVQSQAPQQYELPPAPAAGPAA---PQQQAVGAPQYV 320
           S  PQQ  P P      +   +     Q  QQ+  P  P         PQQ     PQ  
Sbjct: 29  SQQPQQTFPQPQQTFPHQPQQQIPQPQQPQQQFLQPQQPFPQQPQQPYPQQPQQPFPQTQ 88

Query: 321 QQGYVAPQHVAPAEPQQAVPQQHIQAPVPATPAPAATVPQQQPVPQPVVQPAMVAPVTQA 500
           Q   + PQ   P +P    PQQ    P P T  P    PQ Q   QP  QP       Q 
Sbjct: 89  QPQQLFPQSQQPQQPYPQQPQQ----PFPQTQQPQQQFPQSQQPQQPFPQPQQ----PQQ 140

Query: 501 ASPQQ 515
           + PQQ
Sbjct: 141 SFPQQ 145

>emb|CAC10593.1| gamma-gliadin [Aegilops bicornis] gi|10635144|emb|CAC10594.1|
           gamma-gliadin [Aegilops bicornis]
          Length = 300

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 46/117 (39%), Positives = 50/117 (42%), Gaps = 4/117 (3%)
 Frame = +3

Query: 228 SQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQGYVAPQHVAPAEPQQAVPQQHIQAPVP 407
           SQ PQQ   P      P  PQQQ +  PQ  QQ ++ PQ   P +PQQ  PQQ  Q P P
Sbjct: 29  SQQPQQ-TFPQPQQTFPHQPQQQ-IPQPQQPQQQFLQPQQPFPQQPQQPYPQQP-QQPFP 85

Query: 408 ATPAPAATVPQ----QQPVPQPVVQPAMVAPVTQAASPQQTQEDSFFPSAATTVMSF 566
            T  P    PQ    QQP PQ   QP       Q   PQ  Q    FP       SF
Sbjct: 86  QTQQPQQLFPQSQQPQQPYPQQPQQPFPQTQQPQQQFPQSQQPQQPFPQPQQPQQSF 142

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 39/125 (31%), Positives = 45/125 (35%), Gaps = 3/125 (2%)
 Frame = +3

Query: 150 SSHPQQVLPGPNPVSAQEGISKHEVQSQAPQQYELPPAPAAGPAA---PQQQAVGAPQYV 320
           S  PQQ  P P      +   +     Q  QQ+  P  P         PQQ     PQ  
Sbjct: 29  SQQPQQTFPQPQQTFPHQPQQQIPQPQQPQQQFLQPQQPFPQQPQQPYPQQPQQPFPQTQ 88

Query: 321 QQGYVAPQHVAPAEPQQAVPQQHIQAPVPATPAPAATVPQQQPVPQPVVQPAMVAPVTQA 500
           Q   + PQ   P +P    PQQ    P P T  P    PQ Q   QP  QP       Q 
Sbjct: 89  QPQQLFPQSQQPQQPYPQQPQQ----PFPQTQQPQQQFPQSQQPQQPFPQPQQ----PQQ 140

Query: 501 ASPQQ 515
           + PQQ
Sbjct: 141 SFPQQ 145

>emb|CAC10623.1| gamma-gliadin [Aegilops speltoides]
          Length = 255

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 47/126 (37%), Positives = 55/126 (43%), Gaps = 4/126 (3%)
 Frame = +3

Query: 216 HEVQSQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQGYVAPQHVAPAEPQQAVPQQHIQ 395
           H+  SQ PQQ  +P      P  PQQQ    PQ  QQ ++ PQ   P +PQQ  PQQ  Q
Sbjct: 1   HQPFSQQPQQ-TVPQPQQTFPHQPQQQ-FPQPQQPQQQFLQPQQPFPQQPQQPYPQQP-Q 57

Query: 396 APVPATPAPAATVPQ----QQPVPQPVVQPAMVAPVTQAASPQQTQEDSFFPSAATTVMS 563
            P P T  P    PQ    QQP PQ   QP    P  Q   PQ  Q    FP +      
Sbjct: 58  QPFPQTQQPQQLFPQSQQPQQPYPQQPQQPYPQQP--QQPFPQTQQPQQLFPQSQQPQQP 115

Query: 564 FGALPE 581
           +   P+
Sbjct: 116 YPQQPQ 121

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 49/156 (31%), Positives = 55/156 (34%), Gaps = 17/156 (10%)
 Frame = +3

Query: 150 SSHPQQVLPGPNPVSAQEGISKHEVQSQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQG 329
           S  PQQ +P P      +   +     Q  QQ+  P  P      PQQ     PQ  QQ 
Sbjct: 5   SQQPQQTVPQPQQTFPHQPQQQFPQPQQPQQQFLQPQQPF-----PQQPQQPYPQQPQQP 59

Query: 330 YVA-------------PQHVAPAEPQQAVPQQHIQAPVPATPAPAATVPQ----QQPVPQ 458
           +               PQ   P +PQQ  PQQ  Q P P T  P    PQ    QQP PQ
Sbjct: 60  FPQTQQPQQLFPQSQQPQQPYPQQPQQPYPQQP-QQPFPQTQQPQQLFPQSQQPQQPYPQ 118

Query: 459 PVVQPAMVAPVTQAASPQQTQEDSFFPSAATTVMSF 566
              QP       Q   PQ  Q    FP       SF
Sbjct: 119 QPQQPFPQTQQPQQQFPQYQQPQQQFPQPQQPQQSF 154

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 43/131 (32%), Positives = 50/131 (37%), Gaps = 18/131 (13%)
 Frame = +3

Query: 159 PQQVLPG----PNPVSAQEGISKHEVQSQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQ 326
           PQQ  P     P P   Q+   + +   Q   Q + P  P   P  PQQ     PQ    
Sbjct: 40  PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQPY--PQQPQQPYPQQPQQPFP 97

Query: 327 GYVAPQHVAPA--EPQQAVPQQHIQAPVPATPAPAATVPQQQ------PVPQ------PV 464
               PQ + P   +PQQ  PQQ  Q P P T  P    PQ Q      P PQ      P 
Sbjct: 98  QTQQPQQLFPQSQQPQQPYPQQP-QQPFPQTQQPQQQFPQYQQPQQQFPQPQQPQQSFPQ 156

Query: 465 VQPAMVAPVTQ 497
            QP+ V P  Q
Sbjct: 157 QQPSFVQPSLQ 167

>gb|AAG35598.1|AF201084_1 secalin precursor [Secale cereale]
          Length = 455

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 51/127 (40%), Positives = 60/127 (47%), Gaps = 5/127 (3%)
 Frame = +3

Query: 159 PQQVLPG----PNPVSAQEGISKHEVQSQAPQQYELPPAPAAGPAAPQQQAVGAPQY-VQ 323
           PQQ  P     P P   Q+   + + Q Q PQQ + P         PQQ     PQ  +Q
Sbjct: 84  PQQPYPQQPQQPFPQQPQQPYPQ-QPQQQFPQQPQQPVPQQPLQQFPQQPQQPFPQQPLQ 142

Query: 324 QGYVAPQHVAPAEPQQAVPQQHIQAPVPATPAPAATVPQQQPVPQPVVQPAMVAPVTQAA 503
           Q    PQ   P +PQQ VPQQ  Q P P T  P      QQP PQP  QP  + P TQ +
Sbjct: 143 QFPQQPQQPFPQQPQQPVPQQS-QQPFPQTQQP------QQPFPQP-QQPQQLFPQTQQS 194

Query: 504 SPQQTQE 524
           SPQQ Q+
Sbjct: 195 SPQQPQQ 201

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 36/100 (36%), Positives = 41/100 (41%)
 Frame = +3

Query: 225 QSQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQGYVAPQHVAPAEPQQAVPQQHIQAPV 404
           Q Q PQQ   P    + P  PQQ     PQ  QQ +      +  +PQQ  PQQ    P 
Sbjct: 28  QVQCPQQQPFPQPQQSSPQQPQQP---FPQQSQQPFPQQPQQSSPQPQQPYPQQ----PF 80

Query: 405 PATPAPAATVPQQQPVPQPVVQPAMVAPVTQAASPQQTQE 524
           P  P        QQP PQ   QP    P  Q   PQQ Q+
Sbjct: 81  PQQPQQPYPQQPQQPFPQQPQQPYPQQP--QQQFPQQPQQ 118

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 48/140 (34%), Positives = 55/140 (39%), Gaps = 19/140 (13%)
 Frame = +3

Query: 159 PQQVLPGPNPVSAQEGISKHEVQSQAP-QQYELPPAPAAGPAAPQQ----QAVGAPQYVQ 323
           PQQ    P P   Q+ + +   QSQ P  Q + P  P   P  PQQ        +PQ  Q
Sbjct: 148 PQQ----PFPQQPQQPVPQ---QSQQPFPQTQQPQQPFPQPQQPQQLFPQTQQSSPQQPQ 200

Query: 324 QGYVAPQHVAPAE--PQQAVPQQHIQAPVPATPA---PAATVPQ---------QQPVPQP 461
           Q    PQ   P    PQQ+ PQ   Q P P  P    P +  PQ         QQP PQP
Sbjct: 201 QVTSQPQQPFPQAQPPQQSSPQS--QQPYPQEPQQLFPQSQQPQQPFPQPQQPQQPFPQP 258

Query: 462 VVQPAMVAPVTQAASPQQTQ 521
             Q     P  Q   PQ  Q
Sbjct: 259 QPQTQQSIPQPQQPFPQPQQ 278

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 45/133 (33%), Positives = 49/133 (36%), Gaps = 12/133 (9%)
 Frame = +3

Query: 162 QQVLPGPNPVSAQEGISKHEVQSQAPQQYELPPAPAAGPAAPQQQAVGAP--QYVQQGYV 335
           QQ  P P   S Q+       QSQ P     P  P      PQQ     P  Q  QQ Y 
Sbjct: 34  QQPFPQPQQSSPQQPQQPFPQQSQQP----FPQQPQQSSPQPQQPYPQQPFPQQPQQPY- 88

Query: 336 APQHVAP---AEPQQAVPQ-------QHIQAPVPATPAPAATVPQQQPVPQPVVQPAMVA 485
            PQ        +PQQ  PQ       Q  Q PVP  P        QQP PQ  +Q     
Sbjct: 89  -PQQPQQPFPQQPQQPYPQQPQQQFPQQPQQPVPQQPLQQFPQQPQQPFPQQPLQQFPQQ 147

Query: 486 PVTQAASPQQTQE 524
           P  Q   PQQ Q+
Sbjct: 148 P--QQPFPQQPQQ 158

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 42/136 (30%), Positives = 53/136 (38%), Gaps = 7/136 (5%)
 Frame = +3

Query: 159 PQQVLPGPN----PVSAQEGISKHEVQSQAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQ 326
           PQQ +P       P   Q+   +  +Q Q PQQ + P         PQQ     PQ  Q 
Sbjct: 116 PQQPVPQQPLQQFPQQPQQPFPQQPLQ-QFPQQPQQPFPQQPQQPVPQQSQQPFPQTQQP 174

Query: 327 GYVAPQHVAPAEPQQAVPQQHI---QAPVPATPAPAATVPQQQPVPQPVVQPAMVAPVTQ 497
               PQ   P +PQQ  PQ      Q P   T  P    PQ QP       P   +P +Q
Sbjct: 175 QQPFPQ---PQQPQQLFPQTQQSSPQQPQQVTSQPQQPFPQAQP-------PQQSSPQSQ 224

Query: 498 AASPQQTQEDSFFPSA 545
              PQ+ Q+   FP +
Sbjct: 225 QPYPQEPQQ--LFPQS 238

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 44/149 (29%), Positives = 54/149 (35%), Gaps = 19/149 (12%)
 Frame = +3

Query: 150 SSHPQQVLPGPNPVSAQEGISKHEVQS-QAPQQYELPPAPAAGPAAPQQQAVGAPQYVQQ 326
           +  PQQ  P P P   Q+   + +  S Q PQQ    P      A P QQ+  +PQ  Q 
Sbjct: 171 TQQPQQ--PFPQPQQPQQLFPQTQQSSPQQPQQVTSQPQQPFPQAQPPQQS--SPQSQQP 226

Query: 327 GYVAPQHVAPAE-------PQQAVPQQHIQAPVPAT-----------PAPAATVPQQQPV 452
               PQ + P         PQ   PQQ    P P T           P P    PQ Q  
Sbjct: 227 YPQEPQQLFPQSQQPQQPFPQPQQPQQPFPQPQPQTQQSIPQPQQPFPQPQQPFPQSQEQ 286

Query: 453 PQPVVQPAMVAPVTQAASPQQTQEDSFFP 539
              V QP   +P  Q  S Q + +    P
Sbjct: 287 FPQVHQPQQPSPQQQQPSIQLSLQQQLNP 315



EST assemble image


clone accession position
1 HCL040a11_r AV641777 1 499
2 MXL089f10_r BP098227 13 458
3 CL14g11_r AV393884 35 492
4 MXL063f11_r BP096719 235 707




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research