KCC000264A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000264A_C01 KCC000264A_c01
ttcgacgatgggccctggtgggagcaccagcgcgtggagcccatgcccatctccacctcc
atccacctcagcaacatgagCGCACACGGCAAGAGCCACCACAACCAGTCCGTCAGCGTG
GGCCAGCTCAACCCCATTCGCGAGGGCCGCGAGATCGCTGTGTCAGGCGTGCCTGCCACC
GGCCAGCGCTCCGTGGGCGAGATCGCCGTGACCATGCAGGCCGCGCCCGTGATGGCCTCC
TCAGCGCCCGTGATGGGCATGCACGCCGCCGCCGCCACCCCCATCGATACGCCGCTGTTC
GCGGACGGTCACGCCATGGAGAACGCCGCGCGCCCGGTGCAGCCCATGGTGGCCGGCGCC
GGCAACGTGTAGAGCGGCAGACTCGTTCGGTGCTCGGCGGACAAGACACGTTAGTAAAAG
AGATGAAGTAAGACGCTGCGGTTGCAGTCGGCGGGGGCAGCGGCTCCGCGGCCGACTGCG
TGAACTGATGAATGAATGAGTGAGGCGGAGCCGGAAGCCAGGAACGCTTGGGAGTCCTGG
CAATGGTTTGTGCCTTGAGGCTCGGCTTGGCTTGCGTGAGCGAGCGTGCAGAGTGAGGCG
CGCCATGAGCGCGTCGCCTTTGTCTTGCGGTATTGTGAATTGACCTGCTTGTGGCTTGGG
CCGCGTTGGGGATGTCCGGAAGTGCGTCCACGGCTATGATCGGGGTGGGTTACCCATGGT
CGTGGGTGTCTCTATGAGCGCTGAAGCGCAACTGCTGCTGGGCGGAGTTGAAACTGCTGA
GAAGTCCGTGGGGAGAGCGTGTTCACACACGAACACACAAATACACACATGGTGTGCGTG
TGCACTGATTCTTGCCCGTATGGGCCCTGGGATTGTAGCGCCAGTGGGAGTTGTTAGGGC
GTCCCTGAGAGATTTGTGCACGGCGCATATGAGGCGGCAGCAGGAATTCCCCGCCGCGCC
GTACGCGTGGGTGGTCGGACAGATGGTGGCAGTCGCAGGCAGTAACTAGCGTTTTTGTTT
GTGTTTGTGCGCACGCCCTGTGTACTGAGTTGGCCACCGCAGGGTGGCCACTGTACGGTA
TTTTACGAGTGCCAGGGCTGCACCAGTCAGGCTTTCAGTTACACATGGACTAGATAGCAT
TACACACGGACGGTACCTGAGTACCAAGAATCAAGCTATTAGCAATATTACGAATGTCGG
GAACCGGATTGGGCGCACGTTACACATCATTAGAAGTCCGCATGTGTGACGTGTGTATGG
CATCGGGATGCAAGGAAATCCATGTGCTTGCCGGACTGTCGGTTTGAGTGCATCATAGCG
GATTCCCATGCAATAAGGCATTTGCGGCGGCTTGCTAGACCACATACTGCTGCTGCTGCA
CGGTCAAGGCACGGCAGCGGCATGCAGGGGTTAGCATGCGGAAGGCATTTGTGTTACTCA
GGCTGTCCGCGCATGGGTTTGTCTTGGTGTGGTGACGGCATTGTGGTAATATCGGGATGG
CATTAGCTGCAAGCAGCCAAAGCATGATGCTAGATAGCAAGCACGGATGTGGCGGACAGT
GTTGAAGCCAACACGTTTGGCAGGGTTGTGGATGAGTTGACTGCGCAGGTCGTTGCAAAC
CGTTGAGGCAACAGTTCGGTTTGCGGCAGTCGGTAGCATCAAGTTCATGGCTAAATAGGC
GAGCCGGCGATTACATCGCATCTACTTACGTGCGTGACCTACGTGGTACATGGCCCATAC
CACAATTACACATCGAACAGGCACATCCTCAACATACTGTAACATACTAACATTCcc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000264A_C01 KCC000264A_c01
         (1797 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAK14647.1| Rh protein [Chlamydomonas reinhardtii] gi|1722351...   251  2e-65
gb|AAM17923.1| Rh protein homolog-2 [Chlamydomonas reinhardtii] ...    65  3e-09
gb|AAM19665.1| Rh2 protein [Chlamydomonas reinhardtii]                 65  4e-09
ref|XP_290770.2| KIAA1447 protein [Homo sapiens]                       50  2e-04
ref|NP_821286.1| hypothetical protein [Streptomyces avermitilis ...    49  3e-04

>gb|AAK14647.1| Rh protein [Chlamydomonas reinhardtii] gi|17223514|gb|AAK14648.1|
           Rh protein [Chlamydomonas reinhardtii]
          Length = 574

 Score =  251 bits (642), Expect = 2e-65
 Identities = 123/123 (100%), Positives = 123/123 (100%)
 Frame = +1

Query: 1   FDDGPWWEHQRVEPMPISTSIHLSNMSAHGKSHHNQSVSVGQLNPIREGREIAVSGVPAT 180
           FDDGPWWEHQRVEPMPISTSIHLSNMSAHGKSHHNQSVSVGQLNPIREGREIAVSGVPAT
Sbjct: 452 FDDGPWWEHQRVEPMPISTSIHLSNMSAHGKSHHNQSVSVGQLNPIREGREIAVSGVPAT 511

Query: 181 GQRSVGEIAVTMQAAPVMASSAPVMGMHAAAATPIDTPLFADGHAMENAARPVQPMVAGA 360
           GQRSVGEIAVTMQAAPVMASSAPVMGMHAAAATPIDTPLFADGHAMENAARPVQPMVAGA
Sbjct: 512 GQRSVGEIAVTMQAAPVMASSAPVMGMHAAAATPIDTPLFADGHAMENAARPVQPMVAGA 571

Query: 361 GNV 369
           GNV
Sbjct: 572 GNV 574

>gb|AAM17923.1| Rh protein homolog-2 [Chlamydomonas reinhardtii]
           gi|20340033|gb|AAM19664.1|AF500097_1 Rh2 protein
           [Chlamydomonas reinhardtii]
          Length = 638

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 62/174 (35%), Positives = 72/174 (40%), Gaps = 58/174 (33%)
 Frame = +1

Query: 1   FDDGPWWEHQRVEPMPISTSIHLSNM-SAHGK--------SHHNQSVSVGQL---NPIRE 144
           FDDGPWW  QRVEPMPISTSIHLS + S H K        +  N SVS+      NP   
Sbjct: 450 FDDGPWWVGQRVEPMPISTSIHLSTLNSRHQKDGGSTQRGNAANASVSMANTLVPNPAEP 509

Query: 145 GRE--------IAVSGVPAT----------------GQRSVGEIAVT------------M 216
            R         IAVSGVPA                 G  +  EI  +            M
Sbjct: 510 RRHGSACPAAPIAVSGVPAAVAHHSLTVSGQQGAAHGAAAASEIVASVPFLAFQQQQQQM 569

Query: 217 QAA---------PVMASSAPVMGMHAAAATPIDTPLFADG-HAMENAARPVQPM 348
            AA         P M+++  + G         D PLF+D    ME A  PVQPM
Sbjct: 570 AAAAAAAHQYPQPFMSTAVLMGGAAGGGGANNDRPLFSDDVIGMETALAPVQPM 623

>gb|AAM19665.1| Rh2 protein [Chlamydomonas reinhardtii]
          Length = 638

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 62/174 (35%), Positives = 72/174 (40%), Gaps = 58/174 (33%)
 Frame = +1

Query: 1   FDDGPWWEHQRVEPMPISTSIHLSNM-SAHGK--------SHHNQSVSVGQL---NPIRE 144
           FDDGPWW  QRVEPMPISTSIHLS + S H K        +  N SVS+      NP   
Sbjct: 450 FDDGPWWVGQRVEPMPISTSIHLSTLNSRHQKDGGSTQRGNAANASVSMANTLVPNPAEP 509

Query: 145 GRE--------IAVSGVPAT----------------GQRSVGEIAVT------------M 216
            R         IAVSGVPA                 G  +  EI  +            M
Sbjct: 510 RRHGSACPAAPIAVSGVPAAVAHHSLTVSGQQGAAHGAAAASEIVASVPFLAFQQQQQQM 569

Query: 217 QAA---------PVMASSAPVMGMHAAAATPIDTPLFADG-HAMENAARPVQPM 348
            AA         P M+++  + G         D PLF+D    ME A  PVQPM
Sbjct: 570 AAAAAAAHQYPQPFMSTAVLMGGPAGGGGANNDRPLFSDDVIGMETALAPVQPM 623

>ref|XP_290770.2| KIAA1447 protein [Homo sapiens]
          Length = 174

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 37/109 (33%), Positives = 44/109 (39%), Gaps = 8/109 (7%)
 Frame = +2

Query: 68  SAT*AHTARATTTSPSAWASSTPFARAARSLCQACLPPASAPWARSP*PCRPRP*WPPQR 247
           ++T A  +    T+ +A A S    R  R    AC PPAS+P    P P   RP  PPQ 
Sbjct: 27  ASTRARQSSRCPTTATATAPSRTRTRTGRGWRPAC-PPASSPACPCPLPPLARPPPPPQA 85

Query: 248 P*WACTPPPPPPSIRRCSRTVTPWRT--------PRARCSPWWPAPATC 370
           P   C PP   P   R   T    RT            C P WP+P  C
Sbjct: 86  P---CPPPASAPPTTRTRPTAQTTRTRLCCCRPASPTPCPPSWPSPRPC 131

>ref|NP_821286.1| hypothetical protein [Streptomyces avermitilis MA-4680]
           gi|29603748|dbj|BAC67821.1| hypothetical protein
           [Streptomyces avermitilis MA-4680]
          Length = 844

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 38/127 (29%), Positives = 59/127 (45%)
 Frame = +2

Query: 5   TMGPGGSTSAWSPCPSPPPSTSAT*AHTARATTTSPSAWASSTPFARAARSLCQACLPPA 184
           T  P  ++S  +P  S  P+T+ +   + + +T SP+   +STP A  +   C    P  
Sbjct: 637 TQLPEAASSPSTPTDSSKPATTTSTKASTKCSTPSPAPPTTSTPSATESSPPCSPTAPTT 696

Query: 185 SAPWARSP*PCRPRP*WPPQRP*WACTPPPPPPSIRRCSRTVTPWRTPRARCSPWWPAPA 364
           ++P + SP    P P  P + P    T PP PPS  + + T  P   P    SP  P+P 
Sbjct: 697 TSP-SSSP---APAPSTPTKSP--PSTSPPTPPSSPKHANTPPPNSPPGT--SPTPPSPP 748

Query: 365 TCRAADS 385
              +A+S
Sbjct: 749 NSSSANS 755

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 39/127 (30%), Positives = 50/127 (38%)
 Frame = +2

Query: 23   STSAWSPCPSPPPSTSAT*AHTARATTTSPSAWASSTPFARAARSLCQACLPPASAPWAR 202
            ST A + C +P P         A  TT++PSA  SS P +  A +       PA AP   
Sbjct: 660  STKASTKCSTPSP---------APPTTSTPSATESSPPCSPTAPTTTSPSSSPAPAPSTP 710

Query: 203  SP*PCRPRP*WPPQRP*WACTPPPPPPSIRRCSRTVTPWRTPRARCSPWWPAPATCRAAD 382
            +  P    P  PP  P  A TPPP  P       + TP   P +  +   P P+      
Sbjct: 711  TKSPPSTSPPTPPSSPKHANTPPPNSPP----GTSPTPPSPPNSSSANSSPTPSATATHP 766

Query: 383  SFGARRT 403
            S  A  T
Sbjct: 767  SNSASST 773



EST assemble image


clone accession position
1 MX051h07_r BP088110 1 342
2 CM011d11_r AV386945 216 744
3 CM058f10_r AV390341 321 935
4 HC059c02_r AV636420 428 873
5 HC062d10_r AV636655 501 979
6 HC019e06_r AV633326 550 997
7 HC073b05_r AV637436 589 1052
8 CM026f03_r AV387577 598 1224
9 MXL056a11_r BP096291 722 1134
10 HC097c06_r AV639277 736 1207
11 HC008h07_r AV632493 777 1300
12 LCL083d04_r AV630728 783 1110
13 CM024h06_r AV388239 879 1490
14 CM070e10_r AV391301 1186 1817
15 CL14g03_r AV393864 1278 1798




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research