KCC000263A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000263A_C01 KCC000263A_c01
cccagacccgctgcccaggagtccgcaaacaaatatgcatcatcacatgtaacaaagttt
CGTATGATGGTCTGGAATTGACCCCGGAGTGACCCTCTATGCGCACCGCTTCGTTTCTCC
TTCTCTCTTCCCGACACAACAATGACAAAAACAACAGGCTCATATAAGCCTGGTGCTTTC
AAGCCAGCTGAAACTCCCACAAAGACGGGCTCCTCTGCGGCCAAGGGCGCCTCGTCAACG
CCCTCGTCTGGAAGCAAGGCCGGCGCAGCGTCAGGCCTTGTAAAGCCATCCAAGTCCAAA
GATGTAACTTCAACTGGAAAGTCAGCGGCCGTGAAAACCGCTGAGAAGCCTTTGGGCCCA
ACGCCCGCGCGGCGTGCCATGGACGGCCCCGAGCTGGCGGAGCCCACGGAGGCTGAGGTT
GAGAGCGAGATCCAGCAGCTCCTCAAACAAGCTGACGACAGGCAAACTCCTCAGGAGCTA
ACACTGGACCTCATTGTGAATGCGCACA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000263A_C01 KCC000263A_c01
         (508 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]                       43  0.002
gb|AAQ82688.1| Epa4p [Candida glabrata]                                42  0.003
ref|NP_787279.1| unknown [Tropheryma whipplei str. Twist] gi|284...    41  0.007
ref|XP_315379.1| ENSANGP00000020890 [Anopheles gambiae] gi|21299...    41  0.010
pir||T46707 proteophosphoglycan, membrane-associated [imported] ...    41  0.010

>gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]
          Length = 1325

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 26/111 (23%), Positives = 46/111 (41%)
 Frame = +1

Query: 82   PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKA 261
            P S    AP   S S P ++ +  + S        +  P+ + SSA   +SS PS+ S +
Sbjct: 985  PSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS 1044

Query: 262  GAASGLVKPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
              +S    PS S     +  S++  +A     P+ +  A      + P+ +
Sbjct: 1045 APSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 1095

 Score = 40.8 bits (94), Expect = 0.010
 Identities = 24/104 (23%), Positives = 44/104 (42%)
 Frame = +1

Query: 103  APLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKAGAASGLV 282
            AP   S S P ++ +  + S        +  P+ + SSA   +SS PS+ S +  +S   
Sbjct: 700  APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 759

Query: 283  KPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
             PS S     +  S++  +A     P+ +  A      + P+ +
Sbjct: 760  APSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 803

 Score = 38.9 bits (89), Expect = 0.037
 Identities = 26/113 (23%), Positives = 46/113 (40%), Gaps = 2/113 (1%)
 Frame = +1

Query: 82   PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGA--FKPAETPTKTGSSAAKGASSTPSSGS 255
            P S    AP   S S P ++ +    +    A     +  P+ + SSA   +SS PS+ S
Sbjct: 907  PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS 966

Query: 256  KAGAASGLVKPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
             +  +S    PS S     +  S++  +A     P+ +  A      + P+ +
Sbjct: 967  SSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 1019

 Score = 38.9 bits (89), Expect = 0.037
 Identities = 25/111 (22%), Positives = 44/111 (39%)
 Frame = +1

Query: 82   PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKA 261
            P S    AP   S S P ++ +  + S        +  P+ + SSA   +SS PS+ S +
Sbjct: 800  PSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS 859

Query: 262  GAASGLVKPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
              +S    PS S     +  S+A   +      + +  A      + P+ +
Sbjct: 860  APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS 910

 Score = 36.6 bits (83), Expect = 0.18
 Identities = 23/104 (22%), Positives = 42/104 (40%)
 Frame = +1

Query: 103 APLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKAGAASGLV 282
           AP   S S P ++ +  + S        +  P+ + SSA   +SS PS+ S +  +S   
Sbjct: 685 APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 744

Query: 283 KPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
            PS S     +  S+A   +      + +  A      + P+ +
Sbjct: 745 APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS 788

 Score = 35.4 bits (80), Expect = 0.41
 Identities = 21/88 (23%), Positives = 40/88 (44%)
 Frame = +1

Query: 151 TTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKAGAASGLVKPSKSKDVTSTGKSAA 330
           T  + KP     +  P+ + SSA+  +SS PS+ S +  +S    PS S   ++   S++
Sbjct: 656 TENACKPETESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSS-SAPSSSSS 714

Query: 331 VKTAEKPLGPTPARRAMDGPELAEPTEA 414
             +A     P+ +  A      + P+ +
Sbjct: 715 APSASSSSAPSSSSSAPSASSSSAPSSS 742

 Score = 35.0 bits (79), Expect = 0.54
 Identities = 20/95 (21%), Positives = 40/95 (42%)
 Frame = +1

Query: 103  APLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKAGAASGLV 282
            AP   S S P ++ +  + S        +  P+ + SSA   +SS PS+ S +  +S   
Sbjct: 1007 APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 1066

Query: 283  KPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDG 387
                +   ++   S++  +A     P+ +   + G
Sbjct: 1067 SAPSASSSSAPSSSSSAPSASSSSAPSSSSSFLSG 1101

 Score = 34.3 bits (77), Expect = 0.92
 Identities = 23/112 (20%), Positives = 45/112 (39%), Gaps = 1/112 (0%)
 Frame = +1

Query: 82   PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGA-FKPAETPTKTGSSAAKGASSTPSSGSK 258
            P S    AP   S S P ++ +    +    A    +  P+ + SSA   +SS PS+ S 
Sbjct: 923  PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS 982

Query: 259  AGAASGLVKPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
            +  +S       +   ++   S++  +A     P+ +  A      + P+ +
Sbjct: 983  SAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 1034

 Score = 34.3 bits (77), Expect = 0.92
 Identities = 23/104 (22%), Positives = 44/104 (42%)
 Frame = +1

Query: 103 APLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKAGAASGLV 282
           AP   S S   ++ +  + S        +  P+ + SSA   +SS PS+ S +  +S   
Sbjct: 670 APSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 729

Query: 283 KPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
            PS S   ++   S++  +A     P+ +  A      + P+ +
Sbjct: 730 APSASSS-SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 772

 Score = 32.0 bits (71), Expect = 4.5
 Identities = 19/94 (20%), Positives = 42/94 (44%)
 Frame = +1

Query: 133 DTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKAGAASGLVKPSKSKDVTS 312
           +++ +  + S    +   +  P+ + SSA   +SS PS+ S +  +S    PS S   ++
Sbjct: 665 ESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS-SA 723

Query: 313 TGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
              S++  +A     P+ +  A      + P+ +
Sbjct: 724 PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 757

 Score = 32.0 bits (71), Expect = 4.5
 Identities = 21/105 (20%), Positives = 44/105 (41%), Gaps = 1/105 (0%)
 Frame = +1

Query: 103  APLRFSFSLPDTTMTKTTGSYKPG-AFKPAETPTKTGSSAAKGASSTPSSGSKAGAASGL 279
            AP   S S P ++ +  + S     +   +  P+ + SSA   +SS PS+ S +  +S  
Sbjct: 745  APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS 804

Query: 280  VKPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
                 +   ++   S++  +A     P+ +  A      + P+ +
Sbjct: 805  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 849

>gb|AAQ82688.1| Epa4p [Candida glabrata]
          Length = 1416

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 32/144 (22%), Positives = 68/144 (47%), Gaps = 2/144 (1%)
 Frame = +1

Query: 1   PRPAAQESANKYASSHVTKFRMMVWN*PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGAF 180
           P P++  S++  +SS  +       +   S    +    S S   ++ + ++ S  P   
Sbjct: 375 PSPSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPS-- 432

Query: 181 KPAETPTKTGSSAAKGASSTPSSGSKAGAASGLVKPSKSKDVTSTGKSAA--VKTAEKPL 354
            P+ + + + SS++  +SS+ SS S + ++S    PS S   +S+  S++  ++ + KP+
Sbjct: 433 -PSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSPSIQPSSKPV 491

Query: 355 GPTPARRAMDGPELAEPTEAEVES 426
            P+PA  + + P    P+     S
Sbjct: 492 DPSPADPS-NNPSSVNPSSVNPSS 514

>ref|NP_787279.1| unknown [Tropheryma whipplei str. Twist] gi|28476158|gb|AAO44248.1|
           unknown [Tropheryma whipplei str. Twist]
          Length = 460

 Score = 41.2 bits (95), Expect = 0.007
 Identities = 33/104 (31%), Positives = 44/104 (41%), Gaps = 2/104 (1%)
 Frame = +1

Query: 166 KPGAFKPAETPTKTGSSAAKGASSTPSSGSKAGAASGLVKPSKSKDVTSTGKSAAVKTAE 345
           KP A KPA  P K   +AAK A + P+      AA    KP+ +K   +   +     A 
Sbjct: 128 KPAAAKPA--PAKP--AAAKPAPAKPAPSEATQAAQPPAKPAAAKPAPAKPAATQATQAP 183

Query: 346 KPLG--PTPARRAMDGPELAEPTEAEVESEIQQLLKQADDRQTP 471
           KP    P PA+ A   P  A+P  +E     Q   K A  +  P
Sbjct: 184 KPAAAKPAPAKPAAAKPAPAKPAPSEATQAAQPPAKPAAAKPAP 227

 Score = 40.4 bits (93), Expect = 0.013
 Identities = 29/90 (32%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 TKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKAGAASGLVKPSKSKDVTSTGKS 324
           T+ T + KP A KPA  P K   +AAK A + P+      AA    KP+ +K   +   +
Sbjct: 177 TQATQAPKPAAAKPA--PAKP--AAAKPAPAKPAPSEATQAAQPPAKPAAAKPAPAKPAA 232

Query: 325 AAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
                A KP  P     A   P    P+EA
Sbjct: 233 TQATQATKPAAPAKPAAAKPAPAKPAPSEA 262

 Score = 35.4 bits (80), Expect = 0.41
 Identities = 29/116 (25%), Positives = 48/116 (41%), Gaps = 4/116 (3%)
 Frame = +1

Query: 136 TTMTKTTGSYKPGAFKPAET-PTKTGSSAAKGASSTPSSGSKAGAASGLVKPSKSKDVTS 312
           T  TK     KP A KPA   P  + ++ A    + P++   A A     KP+ ++   +
Sbjct: 236 TQATKPAAPAKPAAAKPAPAKPAPSEATQAAQPPAKPAAAKPAAAKPAPAKPAATQATQA 295

Query: 313 TGKSAAVK-TAEKPLGPTPARRAMDGPELAEPTEAEVESEI--QQLLKQADDRQTP 471
           T  +A  K  A KP   T +       ++ +P   +  S +   Q+ K A  +  P
Sbjct: 296 TKPAAPAKPAAAKPAAATHSSSTQAPSQVTKPAAEKPSSTVANTQVTKPAAAKPAP 351

 Score = 34.7 bits (78), Expect = 0.70
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 4/117 (3%)
 Frame = +1

Query: 145 TKTTGSYKPGAFKPA----ETPTKTGSSAAKGASSTPSSGSKAGAASGLVKPSKSKDVTS 312
           ++ T + +P A KPA     + T+  SSA K A++ P+    A A     KP+ S + T 
Sbjct: 99  SEATQAAQPPA-KPAAATHSSSTQAPSSAPKPAAAKPAPAKPAAAKPAPAKPAPS-EATQ 156

Query: 313 TGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEAEVESEIQQLLKQADDRQTPQELT 483
             +  A   A KP    PA  A    +  +P  A+         K A  +  P E T
Sbjct: 157 AAQPPAKPAAAKPAPAKPA--ATQATQAPKPAAAKPAPAKPAAAKPAPAKPAPSEAT 211

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 26/85 (30%), Positives = 37/85 (42%), Gaps = 2/85 (2%)
 Frame = +1

Query: 166 KPGAFKPAET-PTKT-GSSAAKGASSTPSSGSKAGAASGLVKPSKSKDVTSTGKSAAVKT 339
           KP A KPA   P  T  + A K A++ P+    A A     KP+ S+         A + 
Sbjct: 163 KPAAAKPAPAKPAATQATQAPKPAAAKPAPAKPAAAKPAPAKPAPSE---------ATQA 213

Query: 340 AEKPLGPTPARRAMDGPELAEPTEA 414
           A+ P  P  A+ A   P   + T+A
Sbjct: 214 AQPPAKPAAAKPAPAKPAATQATQA 238

>ref|XP_315379.1| ENSANGP00000020890 [Anopheles gambiae] gi|21299693|gb|EAA11838.1|
            ENSANGP00000020890 [Anopheles gambiae str. PEST]
          Length = 1158

 Score = 40.8 bits (94), Expect = 0.010
 Identities = 39/158 (24%), Positives = 64/158 (39%), Gaps = 4/158 (2%)
 Frame = +1

Query: 22   SANKYASSHVTKFRMMVWN*PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGAFKPA--ET 195
            +ANK A +   K  M+      + P  A  + + S  D++   +    KP A KPA   T
Sbjct: 684  AANKSAVAATPKAAMVKTPAKAATPAAAAKKAAESSDDSSDDSSEEEAKPAAKKPALAAT 743

Query: 196  PTKTGSSAAKGASSTPSSGSKAGAASGLVKPSKSKDVTSTGKSAAVKTAEKPLG--PTPA 369
            P     + A   ++TP++  K    S     S  ++ T     AAVKT  K      TPA
Sbjct: 744  PKAAAHAKAPAKAATPAATKKQQEDSSSEDSSSEEETTKKPVVAAVKTPAKAAAAVKTPA 803

Query: 370  RRAMDGPELAEPTEAEVESEIQQLLKQADDRQTPQELT 483
            + A       +  E+  +S      +++  ++  Q  T
Sbjct: 804  KTATPAAAAKKAAESSDDSSDDSSEEESTTKKPAQAAT 841

 Score = 35.0 bits (79), Expect = 0.54
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 10/122 (8%)
 Frame = +1

Query: 94  PLCAPLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAK--GASSTPSSGSKAGA 267
           P  A  + + S  D++   +    KP A KP +  T   ++AAK    ++TP++  K  A
Sbjct: 275 PAAAAKKAAESSDDSSEDSSEEESKPAAKKPTQAATPKAAAAAKTPAKAATPAAAVKKAA 334

Query: 268 ASGLVKPSKSKDVTS-------TGKSAAVKTAEKPLGP-TPARRAMDGPELAEPTEAEVE 423
            S       S +  S       T  +AA KT  K   P   A++A +  + +    +E E
Sbjct: 335 ESSDDSSDDSSEEESKPAAKKPTQAAAAAKTPAKAATPAAAAKKAAESSDDSSDDSSEEE 394

Query: 424 SE 429
           S+
Sbjct: 395 SK 396

 Score = 34.7 bits (78), Expect = 0.70
 Identities = 35/125 (28%), Positives = 54/125 (43%), Gaps = 13/125 (10%)
 Frame = +1

Query: 94  PLCAPLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAK--GASSTPSSGSKAGA 267
           P  A  + + S  D++   +    KP A K A   T   ++AAK    ++TP+  +K  A
Sbjct: 607 PAAAAKKTAESSDDSSDDSSDEDSKPAAKKSAVAATPKAAAAAKTPAKAATPAVAAKKAA 666

Query: 268 ASG----------LVKPSKSKD-VTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
            S             KP+ +K  V +T K+A VKT  K    TPA  A    E ++ +  
Sbjct: 667 ESSDDSSDDSSEDECKPAANKSAVAATPKAAMVKTPAK--AATPAAAAKKAAESSDDSSD 724

Query: 415 EVESE 429
           +   E
Sbjct: 725 DSSEE 729

 Score = 33.1 bits (74), Expect = 2.0
 Identities = 34/114 (29%), Positives = 50/114 (43%), Gaps = 6/114 (5%)
 Frame = +1

Query: 94  PLCAPLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGAS--STPSSGSKAGA 267
           P  A  + + S  D++   +    KP A KPA+  T   ++AAK  +  +TP++ +K  A
Sbjct: 556 PAAAAKKAAESSEDSSDDSSEEESKPAAKKPAQAATPKVAAAAKTPAKVATPAAAAKKTA 615

Query: 268 ASGLVKPSKSKDVTS--TGKSAAVKTAEK--PLGPTPARRAMDGPELAEPTEAE 417
            S       S D  S    K +AV    K      TPA+ A   P +A    AE
Sbjct: 616 ESSDDSSDDSSDEDSKPAAKKSAVAATPKAAAAAKTPAKAAT--PAVAAKKAAE 667

 Score = 31.6 bits (70), Expect = 5.9
 Identities = 44/183 (24%), Positives = 68/183 (37%), Gaps = 32/183 (17%)
 Frame = +1

Query: 4   RPAAQESANKYASSHVTKFRMMVWN*PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGAFK 183
           +PAA++ A   A++              + P  A  + + S  D++   +    KP A K
Sbjct: 442 KPAAKKPAQAAAAAKTPA--------KAATPAAAAKKAAESSDDSSDDSSEEESKPAAKK 493

Query: 184 P------AETPTKTGSSAA---KGASST-------------PSSGSKAGAASGLVKPSKS 297
           P      A+TP KT + AA   K A S+             P++   A AA+    P K 
Sbjct: 494 PTQAAAAAKTPAKTATPAAAAKKAAESSDDSSDDSSEEDSKPAAKKPAQAAAAAKTPVKV 553

Query: 298 KDVTSTGKSAAVKTAE----------KPLGPTPARRAMDGPELAEPTEAEVESEIQQLLK 447
               +  K AA  + +          KP    PA+ A      A  T A+V +      K
Sbjct: 554 ATPAAAAKKAAESSEDSSDDSSEEESKPAAKKPAQAATPKVAAAAKTPAKVATPAAAAKK 613

Query: 448 QAD 456
            A+
Sbjct: 614 TAE 616

>pir||T46707 proteophosphoglycan, membrane-associated [imported] - Leishmania
           major (fragment) gi|5420389|emb|CAB46680.1|
           proteophosphoglycan [Leishmania major]
          Length = 383

 Score = 40.8 bits (94), Expect = 0.010
 Identities = 24/94 (25%), Positives = 40/94 (42%)
 Frame = +1

Query: 82  PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPSSGSKA 261
           P S    AP   S S P ++ +  + S        +  P+ + SSA   +SS PS+ S +
Sbjct: 65  PSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS 124

Query: 262 GAASGLVKPSKSKDVTSTGKSAAVKTAEKPLGPT 363
             +S    PS S     +  S++  +A     P+
Sbjct: 125 APSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS 158

 Score = 35.4 bits (80), Expect = 0.41
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = +1

Query: 124 SLPDTTMTKTTGSYKPGAFKPAETPTKTGSSAAKGASSTPS-SGSKAGAASGLVKPSKSK 300
           S P ++ +  + S        +  P+ + SSA   +SS PS S S A ++S    PS S 
Sbjct: 2   SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASS 61

Query: 301 DVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
               +  S++  +A     P+ +  A      + P+ +
Sbjct: 62  SSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 99

 Score = 35.0 bits (79), Expect = 0.54
 Identities = 25/112 (22%), Positives = 44/112 (38%), Gaps = 1/112 (0%)
 Frame = +1

Query: 82  PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGA-FKPAETPTKTGSSAAKGASSTPSSGSK 258
           P S    AP   S S P ++ +    +    A    +  P+ + SSA   +SS PS+ S 
Sbjct: 49  PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS 108

Query: 259 AGAASGLVKPSKSKDVTSTGKSAAVKTAEKPLGPTPARRAMDGPELAEPTEA 414
           +  +S    PS S     +  S+A   +      + +  A      + P+ +
Sbjct: 109 SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS 160

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 5/100 (5%)
 Frame = +1

Query: 82  PRSDPLCAPLRFSFSLPDTTMTKTTGSYKPGA--FKPAETPTKTGSSAAKGASSTPS-SG 252
           P S    AP   S S P ++ +    +    A     +  P+ + SSA   +SS PS S 
Sbjct: 141 PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS 200

Query: 253 SKAGAASGLVKPSKSKDVTSTGKSAAVKTAE--KPLGPTP 366
           S A ++S    PS S     +  S+A  ++     + PTP
Sbjct: 201 SSAPSSSSSSAPSASSSSAPSSSSSAPSSSSTTTTMDPTP 240



EST assemble image


clone accession position
1 CL45b05_r AV397783 1 509
2 HCL002h05_r AV639675 61 486
3 CL14f10_r AV393895 72 377




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research