KCC000261A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000261A_C01 KCC000261A_c01
CTTATTACAACAGTGACCTTGCAGACCACACATATTCTTCAGCCTTTTAGAAGCGAGGCT
AAACACACATAACATGGTCAAAACAAGGCACCAAGAGGAGGTTGAGGCGGCTGGGGCTCC
TGTAGCTGAAAAGAAGGTTAAGAAGGCCAAGGCGTCCGAGGATGGCGCGGCACCGAAACG
GAAACGTGCGACTGAGGTAGACGCAGAGCCGGCGGCCATCGAAAAGCCCAAGAAGAAGAA
GGCCGCGGCGGAGGCCGCTGACGGTGACGCCGCCCCTGCTAAGAAGGTAAAGAAGGTCAA
GGCTGCGTCAGAGGACAGCGAGGAGCCTGTGAAGCCGCCGACGAAGCTCGCTGCAATCAC
TGCCGCGACGCCCACGAGCGAGCTCGGCTTGGACCGCTTCAAGCTGTCGGAGCAGGTCAA
GTCGATGCTGCGAAGCCAAAACATCGAGTCGCTCTTCCCCATCCAAGCTATGACGCTGGA
GCCGGCCATGGAGGGCCTCGACGTCGTCGGCCGCGCTCGTACGGGTTGCGGCAAGACGCT
GGCCTTCACGGTGCCCGTCGTCGAGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000261A_C01 KCC000261A_c01
         (567 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T09159 RNA helicase prh75 - spinach gi|1488647|emb|CAA68193...    88  9e-17
ref|NP_201025.1| DEAD box RNA helicase (prh75), putative [Arabid...    82  7e-15
emb|CAA68194.1| RNA helicase [Arabidopsis thaliana]                    82  7e-15
gb|AAK62631.1| AT5g62190/mmi9_10 [Arabidopsis thaliana]                80  3e-14
gb|AAF40306.1|AF156667_1 RNA helicase [Vigna radiata]                  79  4e-14

>pir||T09159 RNA helicase prh75 - spinach gi|1488647|emb|CAA68193.1| RNA
           helicase [Spinacia oleracea]
          Length = 685

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 54/152 (35%), Positives = 85/152 (55%), Gaps = 6/152 (3%)
 Frame = +2

Query: 128 EKKVKKAKASEDGAAPKRKRATEVDAEPAAI-----EKPKKKKAAAEAADGDAAPAKKVK 292
           EKK+K      D    K+++++    E ++      ++ K+KK   +A D D +  K   
Sbjct: 19  EKKMKSETLDSDDTVVKKEKSSSKKKEKSSSSGKKDKEEKEKKKKRKAVDLDDSSDKSDN 78

Query: 293 KVKAASEDSEEPVKPPT-KLAAITAATPTSELGLDRFKLSEQVKSMLRSQNIESLFPIQA 469
             +    D  +P K    + A + A  P S   L  F++S+ +K +L S+ I++LFPIQA
Sbjct: 79  SSELVQADDLKPKKAKVMEEAVVEAEDPNS---LSNFRISKPLKDVLISKGIKALFPIQA 135

Query: 470 MTLEPAMEGLDVVGRARTGCGKTLAFTVPVVE 565
           MT +  ++G D+VGRARTG GKTLAF +P+VE
Sbjct: 136 MTFDNVIDGCDLVGRARTGQGKTLAFVLPIVE 167

>ref|NP_201025.1| DEAD box RNA helicase (prh75), putative [Arabidopsis thaliana]
           gi|8809632|dbj|BAA97183.1| RNA helicase [Arabidopsis
           thaliana] gi|15810145|gb|AAL07216.1| putative RNA
           helicase [Arabidopsis thaliana]
           gi|30793911|gb|AAP40408.1| putative DEAD/DEAH box RNA
           helicase PRH75 [Arabidopsis thaliana]
          Length = 671

 Score = 81.6 bits (200), Expect = 7e-15
 Identities = 57/161 (35%), Positives = 86/161 (53%), Gaps = 15/161 (9%)
 Frame = +2

Query: 128 EKKVKKAKA-------SEDGAAPKRKRATEVDAEPAAIEKPKKK----KAAAEA----AD 262
           EKK+KK  A       S+ G   ++ + ++ D E +  +K KKK    KA+ E     +D
Sbjct: 12  EKKMKKKMALDTPELDSKKGKKEQKLKLSDSDEEESEKKKSKKKDKKRKASEEEDEVKSD 71

Query: 263 GDAAPAKKVKKVKAASEDSEEPVKPPTKLAAITAATPTSELGLDRFKLSEQVKSMLRSQN 442
             +   K  KKVK   ED E  V  P  ++              +F++S  ++  L++  
Sbjct: 72  SSSEKKKSSKKVKLGVEDVE--VDNPNAVS--------------KFRISAPLREKLKANG 115

Query: 443 IESLFPIQAMTLEPAMEGLDVVGRARTGCGKTLAFTVPVVE 565
           IE+LFPIQA T +  ++G D+VGRARTG GKTLAF +P++E
Sbjct: 116 IEALFPIQASTFDMVLDGADLVGRARTGQGKTLAFVLPILE 156

>emb|CAA68194.1| RNA helicase [Arabidopsis thaliana]
          Length = 671

 Score = 81.6 bits (200), Expect = 7e-15
 Identities = 57/161 (35%), Positives = 86/161 (53%), Gaps = 15/161 (9%)
 Frame = +2

Query: 128 EKKVKKAKA-------SEDGAAPKRKRATEVDAEPAAIEKPKKK----KAAAEA----AD 262
           EKK+KK  A       S+ G   ++ + ++ D E +  +K KKK    KA+ E     +D
Sbjct: 12  EKKMKKKMALDTPELDSKKGKKEQKLKLSDSDEEESEKKKSKKKDKKRKASEEEDEVKSD 71

Query: 263 GDAAPAKKVKKVKAASEDSEEPVKPPTKLAAITAATPTSELGLDRFKLSEQVKSMLRSQN 442
             +   K  KKVK   ED E  V  P  ++              +F++S  ++  L++  
Sbjct: 72  SSSEKKKSSKKVKLGVEDVE--VDNPNAVS--------------KFRISAPLREKLKANG 115

Query: 443 IESLFPIQAMTLEPAMEGLDVVGRARTGCGKTLAFTVPVVE 565
           IE+LFPIQA T +  ++G D+VGRARTG GKTLAF +P++E
Sbjct: 116 IEALFPIQASTFDMVLDGADLVGRARTGQGKTLAFVLPILE 156

>gb|AAK62631.1| AT5g62190/mmi9_10 [Arabidopsis thaliana]
          Length = 671

 Score = 79.7 bits (195), Expect = 3e-14
 Identities = 56/161 (34%), Positives = 85/161 (52%), Gaps = 15/161 (9%)
 Frame = +2

Query: 128 EKKVKKAKA-------SEDGAAPKRKRATEVDAEPAAIEKPKKK----KAAAEA----AD 262
           EKK+KK  A       S+ G   ++ + ++ D E +  +K KKK    KA+ E     +D
Sbjct: 12  EKKMKKKMALDTPELDSKKGKKEQKLKLSDSDEEESEKKKSKKKDKKRKASEEEDEVKSD 71

Query: 263 GDAAPAKKVKKVKAASEDSEEPVKPPTKLAAITAATPTSELGLDRFKLSEQVKSMLRSQN 442
             +   K  KKVK   ED E  V  P  ++              +F++   ++  L++  
Sbjct: 72  SSSEKKKSSKKVKLGVEDVE--VDNPNAVS--------------KFRIPAPLREKLKANG 115

Query: 443 IESLFPIQAMTLEPAMEGLDVVGRARTGCGKTLAFTVPVVE 565
           IE+LFPIQA T +  ++G D+VGRARTG GKTLAF +P++E
Sbjct: 116 IEALFPIQASTFDMVLDGADLVGRARTGQGKTLAFVLPILE 156

>gb|AAF40306.1|AF156667_1 RNA helicase [Vigna radiata]
          Length = 713

 Score = 79.0 bits (193), Expect = 4e-14
 Identities = 54/146 (36%), Positives = 79/146 (53%)
 Frame = +2

Query: 128 EKKVKKAKASEDGAAPKRKRATEVDAEPAAIEKPKKKKAAAEAADGDAAPAKKVKKVKAA 307
           +KK KK KAS+  A      A E D     +E    ++   +         KK KK KA 
Sbjct: 59  QKKAKKRKASDIEAMAATNDADE-DTSSELVEPESSREDDHK---------KKKKKKKAK 108

Query: 308 SEDSEEPVKPPTKLAAITAATPTSELGLDRFKLSEQVKSMLRSQNIESLFPIQAMTLEPA 487
           SE  E+P+    +        P +   + + ++SE ++  L+ + IESLFPIQAMT +  
Sbjct: 109 SE--EQPLVMEAEEKEEKKEDPNA---VSKLRISEPLRLKLKEKGIESLFPIQAMTFDLV 163

Query: 488 MEGLDVVGRARTGCGKTLAFTVPVVE 565
           ++G D+VGRARTG GKTLAF +P++E
Sbjct: 164 LDGSDLVGRARTGQGKTLAFVLPILE 189



EST assemble image


clone accession position
1 HCL079g11_r AV643995 1 547
2 CL59e05_r AV397892 115 674
3 CL14f04_r AV393858 129 536
4 CL40d06_r AV395385 134 634
5 CL19f05_r AV394172 138 630




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research