KCC000260A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000260A_C01 KCC000260A_c01
tgcaaacggcTTGTGTTCGGCTTATCATAAACTTGCTGCAAATTGCTCACAAAACATCAG
CTGCAGACAACGAGCAAGCTTACAACGTTTCGGTGAAATTCTTCTTTGACAACTTTCCTG
CCGCGAGCTGCGAAAACTTTTCAACCATGGACGACGCTACACGTCGTCTGCGGGTGGTGT
CGGGCCACTTCAACGTGGAGAAGCCCGCTGCGCAGCAAATGCGAGCGCCGTTTGACGTCG
CCGAGCTGCAGCGCATCATAGACCACGACAACCACGAGCATCGCCAGGCCATGAAGGATT
TCATGCGAAACGACGACGTCTACGTTCCGCAATACGACATCAGCCTGGCGGAGGAGCGCG
AGCTGGCGCTGCAGCGGCTGCGGCGCATCTGCCGCGCCGGCTTCATTTCGGTGACGGACT
TCCGAGAGAACCCCTTCCGCATCTTCGCCGCGCACGAGGTGGCGGCCATGTGCGACCCCA
GCATGGCCACCAAGATGACGGTGCAGTTCAACCTGTTTGGCGGCACGGTCCTGAAGCTGG
GCAGCGAGCGGCACCACGGCCCCTTCCTGCGCCAGATCGACATGTTTGACAGCGTGGGCT
GCTTCGCGCTCACGGAGCTGGGCTTCGGCAACAACGCGGTGGAGATGCAGACCACGGCGG
TGTACGACGCGGGCACGCAGACCTTCGTGATCAACACGCCCGGCAGCCTGGCCCAGAAGT
ACTGAATCACCAACAGCGCCGTGCACGCGCAGTGGGCGGTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000260A_C01 KCC000260A_c01
         (761 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T07901 acyl CoA oxidase homolog - cucurbit gi|3115374|gb|AA...   112  8e-24
gb|AAO51949.1| similar to Cucurbita cv. Kurokawa Amakuri. Acyl C...   111  1e-23
gb|AAO51951.1| similar to Cucurbita cv. Kurokawa Amakuri. Acyl C...   109  4e-23
ref|NP_445791.1| acyl-Coenzyme A oxidase 3, pristanoyl [Rattus n...   105  6e-22
ref|NP_172120.2| acyl-CoA oxidase ACX3 -related [Arabidopsis tha...   105  1e-21

>pir||T07901 acyl CoA oxidase homolog - cucurbit gi|3115374|gb|AAC15870.1| acyl
           CoA oxidase homolog [Cucurbita sp. cv. Kurokawa Amakuri]
          Length = 690

 Score =  112 bits (279), Expect = 8e-24
 Identities = 65/176 (36%), Positives = 99/176 (55%), Gaps = 1/176 (0%)
 Frame = +3

Query: 234 DVAELQRIIDHDNHEHRQAMKDFMRNDDVYVPQYDISLAEERELALQRLRRICR-AGFIS 410
           D+  L   +   + E ++ + ++  +         IS+A+ REL +++L  + R AG   
Sbjct: 57  DMGSLSLYMRGKHREIQERVFEYFNSRPELQTPVGISMADHRELCMKQLVGLVREAGIRP 116

Query: 411 VTDFRENPFRIFAAHEVAAMCDPSMATKMTVQFNLFGGTVLKLGSERHHGPFLRQIDMFD 590
                E+P + FA  E     D S+A KM VQF+L+GG+V+ LG+++H   F   ID  D
Sbjct: 117 FRFVNEDPAKYFAIMEAVGSVDVSLAIKMGVQFSLWGGSVINLGTKKHRDRFFDGIDNVD 176

Query: 591 SVGCFALTELGFGNNAVEMQTTAVYDAGTQTFVINTPGSLAQKY*ITNSAVHAQWA 758
             GCFA+TEL  G+N   +QTTA +D  T  F+INTP   A K+ I N+AVH ++A
Sbjct: 177 YPGCFAMTELHHGSNVQGLQTTATFDPITDEFIINTPNDGAIKWWIGNAAVHGKFA 232

>gb|AAO51949.1| similar to Cucurbita cv. Kurokawa Amakuri. Acyl CoA oxidase homolog
           [Dictyostelium discoideum]
          Length = 629

 Score =  111 bits (277), Expect = 1e-23
 Identities = 60/191 (31%), Positives = 111/191 (57%), Gaps = 2/191 (1%)
 Frame = +3

Query: 195 VEKPAAQQMRAPFDVAELQRIIDH-DNHEHRQAMKDFMRNDDVYVPQY-DISLAEERELA 368
           +EK     +    +V EL+ +ID  +  +++   ++F+RN   +   +  + +A  R+L 
Sbjct: 28  LEKELFNSIDTNINVGELKLLIDSVEESKYKDETREFIRNHPKFKENFIGLDMATYRQLV 87

Query: 369 LQRLRRICRAGFISVTDFRENPFRIFAAHEVAAMCDPSMATKMTVQFNLFGGTVLKLGSE 548
           L++   I   G I  TD + N  R   A E+ A+ + ++ TK++VQ+ LFGG ++ LG+ 
Sbjct: 88  LEQCAAIANRGLIHFTDIKNNLHRYIGALEMFALYNNNILTKLSVQYTLFGGPIIFLGTS 147

Query: 549 RHHGPFLRQIDMFDSVGCFALTELGFGNNAVEMQTTAVYDAGTQTFVINTPGSLAQKY*I 728
           RH   ++   +   ++GCFA+TE+G G+N   ++TTA YD  T+ F+I++P   ++K+ I
Sbjct: 148 RHE-KYIEDANTLKTMGCFAMTEIGHGSNVRGIETTAHYDKQTKEFIIHSPTPTSEKFWI 206

Query: 729 TNSAVHAQWAV 761
             + +HA +AV
Sbjct: 207 GCAYLHATYAV 217

>gb|AAO51951.1| similar to Cucurbita cv. Kurokawa Amakuri. Acyl CoA oxidase homolog
           [Dictyostelium discoideum]
          Length = 628

 Score =  109 bits (273), Expect = 4e-23
 Identities = 58/189 (30%), Positives = 111/189 (58%), Gaps = 2/189 (1%)
 Frame = +3

Query: 195 VEKPAAQQMRAPFDVAELQRIIDH-DNHEHRQAMKDFMRNDDVYVPQY-DISLAEERELA 368
           +EK     + A  +V EL+ +ID  +  +++ A ++F+RN   +   +  + +A  R+L 
Sbjct: 27  LEKELFNSIDANINVGELKLLIDSVEASKYKDAAREFIRNHPKFKENFIGLDMATYRQLV 86

Query: 369 LQRLRRICRAGFISVTDFRENPFRIFAAHEVAAMCDPSMATKMTVQFNLFGGTVLKLGSE 548
           L++   +  +G I +TD + N  R     E+ ++ + ++ TK+ V + LFGGT++ LG+ 
Sbjct: 87  LEQCVAVANSGLIHLTDIKNNLHRYAGVVEMFSLYNNNVCTKLGVHYTLFGGTIMFLGTS 146

Query: 549 RHHGPFLRQIDMFDSVGCFALTELGFGNNAVEMQTTAVYDAGTQTFVINTPGSLAQKY*I 728
           RH   ++   +   ++GCFA+TE+G G+N   ++TTA YD  T+ F+I++P   ++K+ I
Sbjct: 147 RHE-KYIEDANTLKTMGCFAMTEIGHGSNVRGIETTAHYDKQTKEFIIHSPTPTSEKFWI 205

Query: 729 TNSAVHAQW 755
             S +HA +
Sbjct: 206 GGSYLHATY 214

>ref|NP_445791.1| acyl-Coenzyme A oxidase 3, pristanoyl [Rattus norvegicus]
           gi|2498208|sp|Q63448|CAO3_RAT Acyl-coenzyme A oxidase 3,
           peroxisomal (Pristanoyl-CoA oxidase)
           gi|1483582|emb|CAA64487.1| pristanoyl-CoA oxidase
           [Rattus norvegicus]
          Length = 700

 Score =  105 bits (263), Expect = 6e-22
 Identities = 65/187 (34%), Positives = 100/187 (52%), Gaps = 6/187 (3%)
 Frame = +3

Query: 207 AAQQMRAPFDVAELQRIID-HDNHEHRQAMKDFMRNDDVYVPQY--DISLAEERELALQR 377
           +A + RA F+  EL    D  D  + ++ +   + ND ++   +  D+ L +EREL   R
Sbjct: 22  SAYRARASFNSKELMLFWDGQDVLDFKKTIFSTLENDPLFARPFGADLPLEKERELNFLR 81

Query: 378 LRRICRAGFISVTDFRENPFRIFAAHEVAAMCDPSMATKMTVQFNLFGGTVLKLGSERHH 557
            +R+   GF +  D  +NP +I        M D S+A K  +   +FG T++  GSE HH
Sbjct: 82  CKRVFEYGFFNAEDMLKNPLKILVLMNCLGMYDWSLANKCVLHMLVFGSTIIGSGSE-HH 140

Query: 558 GPFLRQIDMFDSVGCFALTELGFGNNAVEMQTTAVYDAGTQTFVINTPGSLAQKY*ITN- 734
             +L +I   +  GCFALTEL  G+N   M+TTA YD  TQ F++++P   A K+ + N 
Sbjct: 141 FKYLEKIYNLEIFGCFALTELSHGSNTKAMRTTAHYDPATQEFILHSPDFEAAKFWVGNL 200

Query: 735 --SAVHA 749
             +A HA
Sbjct: 201 GKTATHA 207

>ref|NP_172120.2| acyl-CoA oxidase ACX3 -related [Arabidopsis thaliana]
           gi|25406914|pir||H86198 hypothetical protein [imported]
           - Arabidopsis thaliana
           gi|8927669|gb|AAF82160.1|AC068143_2 Contains similarity
           to an acyl-CoA oxidase (ASX2) mRNA from Arabidopsis
           thaliana gb|AF057043 and contains an acyl-CoA oxidase
           PF|01756 domain
          Length = 675

 Score =  105 bits (261), Expect = 1e-21
 Identities = 62/191 (32%), Positives = 102/191 (52%), Gaps = 14/191 (7%)
 Frame = +3

Query: 231 FDVAELQRIIDHDNHEHRQAMKDFM----------RNDDVYV-PQYDISLAEERELALQR 377
           F+V E+++++D  N E R  +   M          R   ++V P Y+ ++ ++R+++++R
Sbjct: 48  FEVKEMRKLLDGHNLEERDWLYGLMMQSNLFNPKQRGGQIFVSPDYNQTMEQQRQISMKR 107

Query: 378 LRRICRAGFISVTDFRENP---FRIFAAHEVAAMCDPSMATKMTVQFNLFGGTVLKLGSE 548
           +  +   G          P    + FA +EV  + D S++ K+ V F L+G  V   G++
Sbjct: 108 IFYLLEKGVFQGWLTETGPEAELKKFALYEVCGIYDYSLSAKLGVHFLLWGNAVKFFGTK 167

Query: 549 RHHGPFLRQIDMFDSVGCFALTELGFGNNAVEMQTTAVYDAGTQTFVINTPGSLAQKY*I 728
           RHH  +L+  + +   GCFA+TELG G N   ++T   YD  T+ FVINTP   AQKY I
Sbjct: 168 RHHEKWLKDTEDYVVKGCFAMTELGHGTNVRGIETVTTYDPTTEEFVINTPCESAQKYWI 227

Query: 729 TNSAVHAQWAV 761
             +A HA  A+
Sbjct: 228 GEAANHANHAI 238



EST assemble image


clone accession position
1 CL62a09_r AV396435 1 512
2 CL14d01_r AV393886 8 465
3 HCL055h01_r AV642673 11 484
4 LCL037d02_r AV628141 13 365
5 HCL010d09_r AV640100 13 167
6 LCL025g05_r AV627371 13 414
7 HCL093b08_r AV644741 13 448
8 LCL044c01_r AV628590 13 477
9 MXL029f12_r BP094788 14 389
10 LCL030f03_r AV627691 15 365
11 LCL048b04_r AV628859 16 331
12 CL67g02_r AV396678 16 552
13 CL36b03_r AV395104 16 488
14 CL32f03_r AV394864 16 538
15 CL74a12_r AV396496 16 522
16 CL62g06_r AV396425 17 535
17 HCL007c05_r AV639921 20 373
18 HCL016a08_r AV640422 20 505
19 LCL066c02_r AV629788 21 365
20 HCL020c02_r AV640667 26 260
21 HCL093e03_r AV644768 26 551
22 HCL017f03_r AV640511 28 540
23 LCL076e04_r AV630274 28 388
24 LCL001a02_r AV626007 36 582
25 HCL027f07_r AV641091 36 448
26 LCL055b12_r AV629248 37 552
27 CL31d04_r AV394996 44 552
28 HCL099b03_r AV645168 47 411
29 CL75d10_r AV397054 47 508
30 LCL035g05_r AV628035 81 550
31 CL33c03_r AV394979 92 593
32 HCL066f01_r AV643269 118 561
33 CL70b04_r AV396822 221 763




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research