KCC000259A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000259A_C01 KCC000259A_c01
CCGACGTAACCTACCAACATAACCAAGAACCGCATAAGCAATGCTGAAAGCCCTTCGGGA
GGCCGGGGGCCAAATTGCAAACTTAGTCCATAGCCACAAGCCGGAGATTAAGCATTCAGC
TCCAAATGTTGCGGATATGGACCCCTCAGAAGGACAGAATGAGTCGGCACCAAACGCAGG
CATTCGGGTCGGAGTGCTGCAAGCAAGCGCGCTGGTTGACCACGTATGCTCAGTCACGCG
CGAGACGTTGGAACGGCTTGCTGGTGCTGAGGTCGCAGGTTCCCAGCGCTGCACGCTGGC
GGAGCTGCAGAACATCCTCTCCTCCGTGGGAGAGTTCCACTCCAAGGCTGGCGGGTCCGA
CAGCAACGTTGGGCGGGCGCTGGCGCTAGGGTTTGGCATTGGCGTGCAGCTGGTCGGTAC
GCGCGGAGCTGACGAGTGGGGCGTCATGTTCACCAGCAGTGTGCACCGCGCGGGCGTGGA
TGTGACGCACATGCGCGTGCAGCCGGACGGGCACACAGGCCGCTCGGCCATCCTCACATG
CGACGGAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000259A_C01 KCC000259A_c01
         (548 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB16906.1| P0005A05.10 [Oryza sativa (japonica cultivar-gro...    74  1e-12
ref|NP_173390.1| ribokinase, putative [Arabidopsis thaliana] gi|...    62  5e-09
pir||PC2022 mucin like protein Muc2 precursor - rat (fragment) g...    47  2e-04
ref|ZP_00087967.1| COG0524: Sugar kinases, ribokinase family [Ps...    44  0.001
gb|AAO51998.1| similar to Leishmania major. Ppg3 [Dictyostelium ...    42  0.005

>dbj|BAB16906.1| P0005A05.10 [Oryza sativa (japonica cultivar-group)]
          Length = 377

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 11/123 (8%)
 Frame = +2

Query: 197 LQASALVDHVCSVTRETLERLAGAEVAGSQRCTLAELQNILSSVG-----------EFHS 343
           LQ SAL+DHV  V    L R+ G +  GSQ+  + EL +IL+ V               +
Sbjct: 37  LQLSALIDHVARVDWSLLNRIPG-DRGGSQQVCIEELNHILAEVNAQILPCRDDLSSIRT 95

Query: 344 KAGGSDSNVGRALALGFGIGVQLVGTRGADEWGVMFTSSVHRAGVDVTHMRVQPDGHTGR 523
            AGGS +N  R L+ GFGI   ++G  G D  GV+F S++  +GVD+T +R +  GHT +
Sbjct: 96  IAGGSVANTIRGLSAGFGISTGIIGACGDDSQGVLFVSNMSFSGVDLTRLRTK-KGHTAQ 154

Query: 524 SAI 532
             +
Sbjct: 155 CLV 157

>ref|NP_173390.1| ribokinase, putative [Arabidopsis thaliana] gi|25513635|pir||F86328
           F14P1.7 protein - Arabidopsis thaliana
           gi|8778428|gb|AAF79436.1|AC025808_18 F18O14.35
           [Arabidopsis thaliana]
           gi|9795587|gb|AAF98405.1|AC024609_6 Unknown protein
           [Arabidopsis thaliana] gi|28466957|gb|AAO44087.1|
           At1g19600 [Arabidopsis thaliana]
          Length = 355

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 43/131 (32%), Positives = 70/131 (52%), Gaps = 6/131 (4%)
 Frame = +2

Query: 170 PNAGIRVGVLQASALVDHVCSVTRETLERLAGAEVAGSQRCTLAELQNILS------SVG 331
           P A + +G LQ +AL+D+V  V    L+++ G +  GS      EL+++L       SV 
Sbjct: 10  PEAPLVLG-LQPAALIDNVAPVDWSLLDQIPG-DRGGSIAVQKDELEHMLKELDAHISVA 67

Query: 332 EFHSKAGGSDSNVGRALALGFGIGVQLVGTRGADEWGVMFTSSVHRAGVDVTHMRVQPDG 511
                AGGS +N  R L++GFG+   ++G  G DE G +F S++  +GV ++ +R +  G
Sbjct: 68  PLKKMAGGSVTNTVRGLSVGFGVATGIIGAYGDDEQGQLFVSNMGFSGVSISRLR-KKKG 126

Query: 512 HTGRSAILTCD 544
            T +   L  D
Sbjct: 127 STAQCVCLVDD 137

>pir||PC2022 mucin like protein Muc2 precursor - rat (fragment)
           gi|435535|emb|CAA82313.1| mucin [Rattus norvegicus]
          Length = 235

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 29/111 (26%), Positives = 55/111 (49%), Gaps = 8/111 (7%)
 Frame = -3

Query: 492 MCVTSTPARCTLLVNMTPHSSAPRVPTSC---TPMPNPSASARPTLLSDPPALEWNSPTE 322
           +C+TSTP   T  +  T  ++   +PTS    TP P+P+ +  PT  +    +  ++ T 
Sbjct: 51  ICITSTPPSTTTEIQTTTSTTKTSIPTSTAMKTPSPSPTTTVTPTPETTTTQISTSTSTT 110

Query: 321 ERMFCSSASVQRWEP-----ATSAPASRSNVSRVTEHTWSTSALACSTPTR 184
            ++   +   +   P      T +PAS + V+ VT  T + ++++ ST T+
Sbjct: 111 TKITTPTPITETSTPISTTSQTPSPASTTTVTPVTTSTTTETSMSLSTTTQ 161

>ref|ZP_00087967.1| COG0524: Sugar kinases, ribokinase family [Pseudomonas fluorescens
           PfO-1]
          Length = 345

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 25/75 (33%), Positives = 38/75 (50%)
 Frame = +2

Query: 296 LAELQNILSSVGEFHSKAGGSDSNVGRALALGFGIGVQLVGTRGADEWGVMFTSSVHRAG 475
           +AE    L+ + +FH +  G+DSNV   L+   G  V  +   GAD  G     ++ R G
Sbjct: 17  VAEQSGDLAFIDQFHKRIAGADSNVAIGLSR-LGFKVAWLSRVGADSLGRFVVETLAREG 75

Query: 476 VDVTHMRVQPDGHTG 520
           +D +H+ V P   TG
Sbjct: 76  LDCSHVEVDPAHPTG 90

>gb|AAO51998.1| similar to Leishmania major. Ppg3 [Dictyostelium discoideum]
          Length = 642

 Score = 42.0 bits (97), Expect = 0.005
 Identities = 35/135 (25%), Positives = 60/135 (43%), Gaps = 1/135 (0%)
 Frame = -3

Query: 483 TSTPARCTLLVNMTPHSSAPRVPT-SCTPMPNPSASARPTLLSDPPALEWNSPTEERMFC 307
           T TP   T    +TP +S+   PT S TP P  S++  PT  S P     + P+    F 
Sbjct: 442 TLTPTN-TSFPTLTPTNSSTPTPTNSSTPTPTNSSTPTPTNSSTPTPTNSSDPSSASSFN 500

Query: 306 SSASVQRWEPATSAPASRSNVSRVTEHTWSTSALACSTPTRMPAFGADSFCPSEGSISAT 127
           SS+S      + S  +  S+    +  ++++++L+ ST +      + S   +  SIS  
Sbjct: 501 SSSSFNSTSSSNSTISPSSSSLNNSTSSFNSTSLSNSTSSSNSTISSSSL-NNTSSISED 559

Query: 126 FGAECLISGLWLWTK 82
           F   C  +   ++ K
Sbjct: 560 FLVSCYFTNSTIFVK 574



EST assemble image


clone accession position
1 HCL002b09_r AV639634 1 211
2 HCL075h08_r AV643781 1 447
3 HCL021b01_r AV640710 1 548
4 CL14b12_r AV393868 12 389
5 CL39a08_r AV395201 45 492




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research