KCC000258A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000258A_C01 KCC000258A_c01
GCTGGGTGACATATACTGAGAGGGCTCATGTTGCACCACCCTCGTCCGTTCCAGTCTGCT
GCTCATAGCCACAAACGCAAAACGACTCCCCTGGCGCAAGCCAATCGTGCATTCCACCTG
TTTAGGCTCGCGATCCCTGCAATTCACAGTGCTGTACCTTCCTATTCTGCTGCTCCACGC
CAGCAGAGACTTGCACAGACCCATCGGGCCGCCACGCTCGTGCGTGCCGTCGCTTCCCCA
GCTTCAGCAATGGTGCATACGAAGGACCATGGCAGTGTGCGCGCTGAGGTCGCCGACCTC
TTCCGGTCGGCGCTGAACACGGCGTACCCAAACGCCGGCATTGAGCCGGTTGTCGCGGCG
TGCAACAACGCTAAGAATGGCGACTATCAGTGCAACAACGCGATGGCGCTGTTTGGCAAG
CTGAAGGGCACGGAGAACGCGCCCAAGGCTCCTCGCGACGTCGCGAACGCGATTCTTGCA
GCGCTGCCGGCGAACGATCTTATTTCGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000258A_C01 KCC000258A_c01
         (508 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_573081.1| CG9020-PA [Drosophila melanogaster] gi|20178140...    60  2e-08
ref|NP_194360.1| arginyl-tRNA synthetase [Arabidopsis thaliana] ...    60  2e-08
emb|CAB11469.1| arginyl-tRNA synthetase [Arabidopsis thaliana]         59  3e-08
pir||T16176 hypothetical protein F26F4.10 - Caenorhabditis elegans     54  1e-06
ref|NP_498035.1| aRginyl aa-tRNA syntheTase (80.9 kD) (rrt-1) [C...    54  1e-06

>ref|NP_573081.1| CG9020-PA [Drosophila melanogaster] gi|20178140|sp|Q9VXN4|SYR_DROME
           Probable arginyl-tRNA synthetase (Arginine--tRNA ligase)
           (ArgRS) gi|7293140|gb|AAF48524.1| CG9020-PA [Drosophila
           melanogaster] gi|17944966|gb|AAL48546.1| RE02962p
           [Drosophila melanogaster]
          Length = 665

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 39/108 (36%), Positives = 59/108 (54%), Gaps = 7/108 (6%)
 Frame = +1

Query: 202 HRAATLVRAVASPASA----MVHTKDHGSVRAEVADLFRSALNTAYPNAGIEPVVAACNN 369
           +R   L +++A  ++A    +   K+  S+   +  +FR A+ +A+P     PV+ A  N
Sbjct: 50  NRLFILKKSIAEESTAAGGDVSKPKESSSITEHLESVFRQAIASAFPEFRDTPVIIAPVN 109

Query: 370 ---AKNGDYQCNNAMALFGKLKGTENAPKAPRDVANAILAALPANDLI 504
              AK GDYQCNNAM L  KLK  +   KAPRD+A  +    PA+ +I
Sbjct: 110 STSAKFGDYQCNNAMGLSKKLK-EKGINKAPRDIATELKGHCPASPII 156

>ref|NP_194360.1| arginyl-tRNA synthetase [Arabidopsis thaliana]
           gi|7437759|pir||T06014 arginine-tRNA ligase (EC
           6.1.1.19) - Arabidopsis thaliana
           gi|2632105|emb|CAB11468.1| arginyl-tRNA synthetase
           [Arabidopsis thaliana] gi|4539426|emb|CAB38959.1|
           arginyl-tRNA synthetase [Arabidopsis thaliana]
           gi|7269482|emb|CAB79485.1| arginyl-tRNA synthetase
           [Arabidopsis thaliana]
          Length = 642

 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 36/107 (33%), Positives = 58/107 (53%), Gaps = 1/107 (0%)
 Frame = +1

Query: 187 RLAQTHRAATLVRAVASPASAMVHTKDHGSVRAEVADLFRSALNTAYPNA-GIEPVVAAC 363
           R A + RA ++V   A+           G+++ ++A LF  +L    P+   +EP+VAA 
Sbjct: 40  RFAFSSRAKSVVAMAANEEFT-------GNLKRQLAKLFDVSLKLTVPDEPSVEPLVAAS 92

Query: 364 NNAKNGDYQCNNAMALFGKLKGTENAPKAPRDVANAILAALPANDLI 504
              K GDYQCNNAM L+  +KG     K P  V  A++ +LP ++++
Sbjct: 93  ALGKFGDYQCNNAMGLWSIIKGKGTQFKGPPAVGQALVKSLPTSEMV 139

>emb|CAB11469.1| arginyl-tRNA synthetase [Arabidopsis thaliana]
          Length = 590

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 30/79 (37%), Positives = 48/79 (59%), Gaps = 1/79 (1%)
 Frame = +1

Query: 271 GSVRAEVADLFRSALNTAYPNA-GIEPVVAACNNAKNGDYQCNNAMALFGKLKGTENAPK 447
           G+++ ++A LF  +L    P+   +EP+VAA    K GDYQCNNAM L+  +KG     K
Sbjct: 9   GNLKRQLAKLFDVSLKLTVPDEPSVEPLVAASALGKFGDYQCNNAMGLWSIIKGKGTQFK 68

Query: 448 APRDVANAILAALPANDLI 504
            P  V  A++ +LP ++++
Sbjct: 69  GPPAVGQALVKSLPTSEMV 87

>pir||T16176 hypothetical protein F26F4.10 - Caenorhabditis elegans
          Length = 709

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 31/80 (38%), Positives = 45/80 (55%), Gaps = 1/80 (1%)
 Frame = +1

Query: 253 VHTKDHGS-VRAEVADLFRSALNTAYPNAGIEPVVAACNNAKNGDYQCNNAMALFGKLKG 429
           V  +D+GS +   +  LF+ A+  A+P   +  ++A   N + GDYQCN+AM +  KLK 
Sbjct: 120 VTVEDYGSSIFGRLQSLFKKAIEDAFPGLDVPLLLAETPNPQFGDYQCNSAMPIAAKLKA 179

Query: 430 TENAPKAPRDVANAILAALP 489
            +   K P DVA  I A LP
Sbjct: 180 NK-INKRPGDVAKEIQAKLP 198

>ref|NP_498035.1| aRginyl aa-tRNA syntheTase (80.9 kD) (rrt-1) [Caenorhabditis
           elegans] gi|21431831|sp|Q19825|SYR_CAEEL Probable
           arginyl-tRNA synthetase (Arginine--tRNA ligase) (ArgRS)
           gi|15789291|gb|AAA91224.2| Arginyl aa-trna synthetase
           protein 1 [Caenorhabditis elegans]
          Length = 713

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 31/80 (38%), Positives = 45/80 (55%), Gaps = 1/80 (1%)
 Frame = +1

Query: 253 VHTKDHGS-VRAEVADLFRSALNTAYPNAGIEPVVAACNNAKNGDYQCNNAMALFGKLKG 429
           V  +D+GS +   +  LF+ A+  A+P   +  ++A   N + GDYQCN+AM +  KLK 
Sbjct: 120 VTVEDYGSSIFGRLQSLFKKAIEDAFPGLDVPLLLAETPNPQFGDYQCNSAMPIAAKLKA 179

Query: 430 TENAPKAPRDVANAILAALP 489
            +   K P DVA  I A LP
Sbjct: 180 NK-INKRPGDVAKEIQAKLP 198



EST assemble image


clone accession position
1 LCL017h10_r AV626912 1 282
2 MXL097g02_r BP098708 1 374
3 LCL016f03_r AV626847 2 508
4 LCL088a09_r AV631044 2 413
5 LCL094f08_r AV631475 3 234
6 LCL004h12_r AV626242 5 492
7 HCL021c06_r AV640720 10 293
8 LCL040g06_r AV628375 13 321
9 CL14a09_r AV393889 14 434
10 HCL023a04_r AV640825 16 471
11 HCL055f10_r AV642666 30 392




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research