KCC000257A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000257A_C01 KCC000257A_c01
cgatatcgatattatatatctgtaacaatttATAGCTTCTAGAAAGACGACGACCCCGCC
TCTACAGAGCTGGTCAAATATGCTGCGGCACGCTTCAAATCCTTAGATCATTTTAAACAA
TACCCAACCATGAAATACCACATGGTAAACAGTATGAACTGGGTAGAGCCTAGTGCGAGG
GCGCGGAGCGCGAGTGCCTTATAAGCTGCACGAGAGCGCGGACGCATGTCCATTACAGCA
TGGGACATCAAGGAGGCTGCCTTCACCTCCGATATCAAGGAGGTGGAGGAGCTCATCCTC
ACAAGCAAAGGCGCCACGGACGTGGGTGCGGTGGCTCAGGCCGCCAACCTGCGCTCGCTG
TCGCTCGCCTTCAACGCGCTCACCAGTCTGTCAGGGCTGGGCGGGTTGGGCCGACTCCAG
TCCCTCAACGTGTCGCACAACCAGCTGGCAAGCCTCAAGGGTGTGCACCTGCTCACGGGC
TTGGCCACCCTCAACGCCAGTCACAACAAGGTGGCGTCGCTGGCTCCGCTGTCGGCGCTG
ACGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000257A_C01 KCC000257A_c01
         (544 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_568416.1| leucine rich repeat protein family [Arabidopsis...    71  1e-11
ref|NP_469635.1| internalin like protein (LPXTG motif) [Listeria...    63  3e-09
ref|NP_463794.1| internalin H [Listeria monocytogenes EGD-e] gi|...    62  4e-09
emb|CAC20635.1| internalin D [Listeria monocytogenes]                  62  4e-09
gb|AAB67969.1| internalin [Listeria monocytogenes]                     62  4e-09

>ref|NP_568416.1| leucine rich repeat protein family [Arabidopsis thaliana]
           gi|9757812|dbj|BAB08330.1| gene_id:MWD9.11~unknown
           protein [Arabidopsis thaliana]
           gi|15912299|gb|AAL08283.1| AT5g22320/MWD9_11
           [Arabidopsis thaliana] gi|19699236|gb|AAL90984.1|
           AT5g22320/MWD9_11 [Arabidopsis thaliana]
          Length = 452

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 42/104 (40%), Positives = 58/104 (55%)
 Frame = +1

Query: 229 SITAWDIKEAAFTSDIKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGL 408
           S+T   + +   T+D   V+EL L  K  TDV  +++  NL  L L FN LT L GL   
Sbjct: 3   SLTVEQVLKEKKTNDPDSVKELNLGHKALTDVSCLSKFKNLEKLDLRFNNLTDLQGLKSC 62

Query: 409 GRLQSLNVSHNQLASLKGVHLLTGLATLNASHNKVASLAPLSAL 540
             L+ L+V  N+L SL G+  LT L  LNA  NK+ S+  +S+L
Sbjct: 63  VNLKWLSVVENKLQSLNGIEALTKLTVLNAGKNKLKSMNEISSL 106

 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 30/98 (30%), Positives = 50/98 (50%)
 Frame = +1

Query: 247 IKEAAFTSDIKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGLGRLQSL 426
           + + +  S  K +E+L L     TD+  +    NL+ LS+  N L SL+G+  L +L  L
Sbjct: 31  LTDVSCLSKFKNLEKLDLRFNNLTDLQGLKSCVNLKWLSVVENKLQSLNGIEALTKLTVL 90

Query: 427 NVSHNQLASLKGVHLLTGLATLNASHNKVASLAPLSAL 540
           N   N+L S+  +  L  L  L  + N+++S+  L  L
Sbjct: 91  NAGKNKLKSMNEISSLVNLRALILNDNEISSICKLDLL 128

>ref|NP_469635.1| internalin like protein (LPXTG motif) [Listeria innocua]
           gi|25514522|pir||AC1469 internalin like protein (LPXTG
           motif) [imported] - Listeria innocua (strain Clip11262)
           gi|16412719|emb|CAC95523.1| internalin like protein
           (LPXTG motif) [Listeria innocua]
          Length = 505

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 32/99 (32%), Positives = 56/99 (56%)
 Frame = +1

Query: 247 IKEAAFTSDIKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGLGRLQSL 426
           I + +  S + ++ +L  T    +D+ AVA   NL SLSL +N ++ +S L  L  L  L
Sbjct: 174 ISDISAVSTLSKLNDLGFTDNQVSDISAVAGLNNLSSLSLGYNQISDISILTNLTNLDGL 233

Query: 427 NVSHNQLASLKGVHLLTGLATLNASHNKVASLAPLSALT 543
           ++ HNQ++ L  +  LT L  +   +N+++ L P++ LT
Sbjct: 234 SIDHNQISDLTPIANLTNLTFVGLHNNQISDLTPIANLT 272

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 31/110 (28%), Positives = 60/110 (54%), Gaps = 5/110 (4%)
 Frame = +1

Query: 229 SITAWDIKEAAFT--SDIKEVEELI---LTSKGATDVGAVAQAANLRSLSLAFNALTSLS 393
           +IT  D+ +   T  S ++ +  L+   L+    +D+ AV+  + L  L    N ++ +S
Sbjct: 141 NITDLDLHDNQITDISPVRNLTNLVVLNLSYNQISDISAVSTLSKLNDLGFTDNQVSDIS 200

Query: 394 GLGGLGRLQSLNVSHNQLASLKGVHLLTGLATLNASHNKVASLAPLSALT 543
            + GL  L SL++ +NQ++ +  +  LT L  L+  HN+++ L P++ LT
Sbjct: 201 AVAGLNNLSSLSLGYNQISDISILTNLTNLDGLSIDHNQISDLTPIANLT 250

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 22/90 (24%), Positives = 48/90 (52%)
 Frame = +1

Query: 274 IKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGLGRLQSLNVSHNQLAS 453
           +  + EL +++   +D+ A+     L  L +  N ++ ++ L  L  +  L++  NQ+  
Sbjct: 95  LTNLTELNISNAEVSDISALKDLTKLTKLEMYQNNISDINVLENLTNITDLDLHDNQITD 154

Query: 454 LKGVHLLTGLATLNASHNKVASLAPLSALT 543
           +  V  LT L  LN S+N+++ ++ +S L+
Sbjct: 155 ISPVRNLTNLVVLNLSYNQISDISAVSTLS 184

>ref|NP_463794.1| internalin H [Listeria monocytogenes EGD-e] gi|25517083|pir||AH1107
           internalin H [imported] - Listeria monocytogenes (strain
           EGD-e) gi|3980135|emb|CAA07457.1| internalin H [Listeria
           monocytogenes] gi|16409628|emb|CAD00790.1| internalin H
           [Listeria monocytogenes]
          Length = 548

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/98 (34%), Positives = 60/98 (60%)
 Frame = +1

Query: 247 IKEAAFTSDIKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGLGRLQSL 426
           +K  +  + ++ ++ L LTS   TDV  +A  +NL+ L L  N +T++S L GL  LQ L
Sbjct: 132 LKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQITNISPLAGLTNLQYL 191

Query: 427 NVSHNQLASLKGVHLLTGLATLNASHNKVASLAPLSAL 540
           ++ + Q++ L  +  L+ L TL A  NK++ ++PL++L
Sbjct: 192 SIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLASL 229

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 26/91 (28%), Positives = 51/91 (55%)
 Frame = +1

Query: 271 DIKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGLGRLQSLNVSHNQLA 450
           ++ ++ EL L+     +V A+A   ++++L L    +T ++ L GL  LQ L +  NQ+ 
Sbjct: 118 NLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQIT 177

Query: 451 SLKGVHLLTGLATLNASHNKVASLAPLSALT 543
           ++  +  LT L  L+  + +V+ L PL+ L+
Sbjct: 178 NISPLAGLTNLQYLSIGNAQVSDLTPLANLS 208

>emb|CAC20635.1| internalin D [Listeria monocytogenes]
          Length = 548

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/98 (34%), Positives = 60/98 (60%)
 Frame = +1

Query: 247 IKEAAFTSDIKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGLGRLQSL 426
           +K  +  + ++ ++ L LTS   TDV  +A  +NL+ L L  N +T++S L GL  LQ L
Sbjct: 132 LKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQITNISPLAGLTNLQYL 191

Query: 427 NVSHNQLASLKGVHLLTGLATLNASHNKVASLAPLSAL 540
           ++ + Q++ L  +  L+ L TL A  NK++ ++PL++L
Sbjct: 192 SIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLASL 229

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 26/91 (28%), Positives = 51/91 (55%)
 Frame = +1

Query: 271 DIKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGLGRLQSLNVSHNQLA 450
           ++ ++ EL L+     +V A+A   ++++L L    +T ++ L GL  LQ L +  NQ+ 
Sbjct: 118 NLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQIT 177

Query: 451 SLKGVHLLTGLATLNASHNKVASLAPLSALT 543
           ++  +  LT L  L+  + +V+ L PL+ L+
Sbjct: 178 NISPLAGLTNLQYLSIGNAQVSDLTPLANLS 208

>gb|AAB67969.1| internalin [Listeria monocytogenes]
          Length = 548

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/98 (34%), Positives = 60/98 (60%)
 Frame = +1

Query: 247 IKEAAFTSDIKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGLGRLQSL 426
           +K  +  + ++ ++ L LTS   TDV  +A  +NL+ L L  N +T++S L GL  LQ L
Sbjct: 132 LKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQITNISPLAGLTNLQYL 191

Query: 427 NVSHNQLASLKGVHLLTGLATLNASHNKVASLAPLSAL 540
           ++ + Q++ L  +  L+ L TL A  NK++ ++PL++L
Sbjct: 192 SIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLASL 229

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 26/91 (28%), Positives = 51/91 (55%)
 Frame = +1

Query: 271 DIKEVEELILTSKGATDVGAVAQAANLRSLSLAFNALTSLSGLGGLGRLQSLNVSHNQLA 450
           ++ ++ EL L+     +V A+A   ++++L L    +T ++ L GL  LQ L +  NQ+ 
Sbjct: 118 NLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQIT 177

Query: 451 SLKGVHLLTGLATLNASHNKVASLAPLSALT 543
           ++  +  LT L  L+  + +V+ L PL+ L+
Sbjct: 178 NISPLAGLTNLQYLSIGNAQVSDLTPLANLS 208



EST assemble image


clone accession position
1 CL14a01_r AV393885 1 313
2 HCL027h03_r AV641105 32 544




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research