KCC000256A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000256A_C01 KCC000256A_c01
atgTAGATCTGTGCATTGATATTAGCCCAATACGTTCAATTTTATAAACCAAGGAAAGAA
TGTCTTCCCTGAAGGCTTGCACCGCCTCCTCCAGCGTCCTGCGCTCTGGCGCGGGAGCGC
GCGCGAGCGGTCGCCGTATCAGCTGCATTGTGACTCGCGCGGCTGAGCCGAAGCAGGGTG
AGGCCAGCACCATCACGCCCCCGCCTAGCAACGAGAAGCCCACCGTGGTGCGGGAGTTCA
CCAGCCACGGCGCGCGCATCATCGAGAGCGATGCGCGCCTGGTGGGCCCGGAGGACCAGC
CAGACCTGTTCGAGGGCGAGAACATGGAGACTCTGGGCAAGGTCATGGAGCGCTTCTTCC
TGCCTGGCCTCATTGTCCTGGGGCTCATCTGCGGAGGCATCGCCGCGCGGTCATACAACG
ACGAGGCCGATGTGTTCATCGCGCCTCCTACCAGCCCCGACGCCGACATTGTGATCATCC
CCGCGGGAGCCCTGCAGTCGACTCCCACTCAGGCGCAGGCACCGTCCGTCAACTAGGCGG
ATTGCCAGTGCGTGACTGCTTGTGGCTTTGGGAGTACTGTGTTACATGTGGAGACACTTG
GGGCAGGAAAAGTATCGACGTGTGA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000256A_C01 KCC000256A_c01
         (625 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_294953.1| hypothetical protein [Deinococcus radiodurans] ...    48  1e-04
ref|XP_294442.1| similar to VENT-like homeobox 2; haemopoietic p...    45  9e-04
ref|ZP_00052545.1| COG1020: Non-ribosomal peptide synthetase mod...    44  0.002
gb|AAA86514.1| similar to Pseudomonas fluorescens uvrC gene prod...    44  0.002
ref|ZP_00057842.1| hypothetical protein [Thermobifida fusca]           42  0.007

>ref|NP_294953.1| hypothetical protein [Deinococcus radiodurans]
           gi|7472709|pir||F75420 hypothetical protein -
           Deinococcus radiodurans (strain R1)
           gi|6458982|gb|AAF10810.1|AE001971_10 hypothetical
           protein [Deinococcus radiodurans]
          Length = 319

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 55/175 (31%), Positives = 72/175 (40%), Gaps = 22/175 (12%)
 Frame = +1

Query: 73  RLAPPPPASCALARERAR---AVAVSAAL*LARLSRSRVRPAPSRPRLATRSPPWCGSSP 243
           R A    +SCA  R+R R     +  ++   A  +R+R  PA S P  +T      G SP
Sbjct: 138 RAASTSGSSCAARRKRRRRHWGSSGPSSGCSANTTRARHAPARSSPLAST------GHSP 191

Query: 244 ATARASSRAMRAWW-ARRTSQTCSRARTWRLWA--------------RSWSASSCLASLS 378
           A +       R W  A R S +  RA + R W               RS  A +     +
Sbjct: 192 AASGWGRSPSRNWCGAARPSVSSGRATSTRCWPAASANSVPKPPSSPRSVRAGTRWGCCT 251

Query: 379 WGSSAEASPRGHTTTRPMCSS----RLLPAPTPTL*SSPREPCSRLPLRRRHRPS 531
           W   A A+PR  TTTR  CS     R+    TP   S+P  P S  P RR  RP+
Sbjct: 252 WTPGAPAAPRA-TTTRNSCSHSPSRRVWRLTTPG--STPSRPASARPPRRCARPA 303

 Score = 32.7 bits (73), Expect = 4.4
 Identities = 37/119 (31%), Positives = 45/119 (37%), Gaps = 5/119 (4%)
 Frame = +1

Query: 157 ARLSRSRVRPAPSRPRLATRSPPWCGSSPATARASSRAMRAWWARRTSQTCSRARTWRLW 336
           AR+ R R   +PSR         W   S            A W RR+   C     WR  
Sbjct: 91  ARVRRDRRSCSPSRRC-------WGWPSKGCRPGKRGGAGAGWPRRSKTWCG---GWR-- 138

Query: 337 ARSWSASSCLASLS-----WGSSAEASPRGHTTTRPMCSSRLLPAPTPTL*SSPREPCS 498
           A S S SSC A        WGSS  +S     TTR    +R  PA +  L S+   P +
Sbjct: 139 AASTSGSSCAARRKRRRRHWGSSGPSSGCSANTTR----ARHAPARSSPLASTGHSPAA 193

>ref|XP_294442.1| similar to VENT-like homeobox 2; haemopoietic progenitor homeobox
           [Homo sapiens]
          Length = 453

 Score = 45.1 bits (105), Expect = 9e-04
 Identities = 42/140 (30%), Positives = 54/140 (38%), Gaps = 3/140 (2%)
 Frame = +1

Query: 85  PPPASCALARERARAVAVSAAL*LARLSRSRVRPAPSRP--RLATRSPPWCGSSPATARA 258
           P P   +  RE  +AV++  A       RS   PAP R    L  +  PW       A+ 
Sbjct: 46  PGPGQTSGTREPPQAVSIKKA-------RSSNLPAPERAVAGLGKKPNPW---QAPCAQP 95

Query: 259 SSRAMRAWWARRTSQTCSRARTWRLW-ARSWSASSCLASLSWGSSAEASPRGHTTTRPMC 435
           S  +  A W   +S T    RTW LW  + W   + L  L     ++      TT     
Sbjct: 96  SPPSRSAPWRASSSTT----RTWALWNGKGWQGDAALGRLDKNLVSKTPDETETTNAG-- 149

Query: 436 SSRLLPAPTPTL*SSPREPC 495
               LPA  P L  SPR PC
Sbjct: 150 ----LPAEQPLLCVSPRAPC 165

>ref|ZP_00052545.1| COG1020: Non-ribosomal peptide synthetase modules and related
           proteins [Magnetospirillum magnetotacticum]
          Length = 676

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 37/101 (36%), Positives = 45/101 (43%), Gaps = 7/101 (6%)
 Frame = +1

Query: 160 RLSRSRVRPAPSRPRLATRSPP----WCGSSPATARASS-RAMRAWWARRTSQTCSRART 324
           R  R R R  P RP   +  PP       SSP+T  +S+  A+   W R +S  C+R R 
Sbjct: 2   RRKRRRCRTVPPRP--CSWPPPNRSSQARSSPSTPISSTISAVTHCWPRASSPPCARPRI 59

Query: 325 WRLWARSWSAS-SCLASLSWGS-SAEASPRGHTTTRPMCSS 441
           WR  A  W  S +C     W   S   SPR   T RP  SS
Sbjct: 60  WR--ASPWKTSTACARCGRWPPVSTSGSPRRAPTVRPTSSS 98

>gb|AAA86514.1| similar to Pseudomonas fluorescens uvrC gene product encoded by
           GenBank Accession Number L29642
          Length = 117

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 35/88 (39%), Positives = 39/88 (43%), Gaps = 1/88 (1%)
 Frame = +2

Query: 101 ALWRGSARERSPYQLHCDSRG*AEAG*GQHHHAPA*QREAHRGAGVHQPRRAHHRERCAP 280
           AL+R +   R P   H    G  EAG G+  HA    R    G G  Q R A        
Sbjct: 11  ALFRAAPARRGPPLGHRRPPG--EAGQGRQRHAA---RRDPGGGGRAQARAARAFRLGQG 65

Query: 281 GGPGGPARPVRGREH-GDSGQGHGALLP 361
           GGPGG AR + GR H GD G  H  L P
Sbjct: 66  GGPGGRARSLXGRGHFGDDGAVHPRLFP 93

>ref|ZP_00057842.1| hypothetical protein [Thermobifida fusca]
          Length = 440

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 43/140 (30%), Positives = 51/140 (35%), Gaps = 14/140 (10%)
 Frame = +2

Query: 182 GQHHHAPA*QREAHRGAGVHQPRRAHHRERCAPGGPGGPA-RPVRG--REHGDSGQGHGA 352
           G  H  P  +R  H G   H+P    H E  +P  PG  A RP RG  R H   G G   
Sbjct: 44  GPRHSRPGQRRPRHHGVSPHRP----HGEPGSPHHPGSAAPRPARGHARLHDRPGSGPVC 99

Query: 353 LLPAWPHCPG-----------AHLRRHRRAVIQRRGRCVHRASYQPRRRHCDHPRGSPAV 499
             PA     G            H  RHRRA   +  R  HR   + RR      RG P  
Sbjct: 100 ARPASHPRVGPAGVGHRGRNPPHSVRHRRACPPQ--RFPHRPVLRTRRPLGIDDRGGPVT 157

Query: 500 DSHSGAGTVRQLGGLPVRDC 559
           +      T+   G +  R C
Sbjct: 158 NPTPAPATLSVCGTVVARYC 177



EST assemble image


clone accession position
1 HC059h12_r AV636471 1 377
2 MX045b09_r BP087862 4 371
3 CL13h04_r AV393936 88 626




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research