KCC000253A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000253A_C01 KCC000253A_c01
CCAGTCGTTGTTCTGACGCGTGTCGTGTCGCGTGCGTTTCTACCTGCCCGCAGCGCCCGC
GCCAGGAGCTCCAAGCACGCGGACGACTTCCAGGTCGCCGCTGCTCTGGAGACTGGATGC
TGGAGCCTGAGGACTGGTCTGGAGGATGAAGCTGAAGCTGAAGTTGAAGTTGAGCTAGTT
AGGCTGCGCACGTGGTTGGCTGTGGTTGGTCTCTACTGTTCAGTGCGGCTCTTGCACGCG
TGTGCGGTTCTAGACTGCATGTCTAGCACATTCACGCGCCGGACTTCCACCGGTCCGGTC
CGGCAGCGCCCTCGATTCTACCTCGAGCCTTTGATGGGGCGCTCTGTCGCTGTGGCTGCT
GGGTAAAGCGTAGCCAGGGGGGCTTACGTCCCTTCCTTGGGGTGTGTGAGGAGTTGGTGG
ACTTCAGACCCCTACGCCGTGTGGGGGGTCGGACTGAGAGGAGAGACTTGACCACAACAA
TGCGGGCGCAGCACCGAGTCTCACCCCCGGGCCCATGAATGCTTCCATTGATGAGCATTG
GCCACACTTGCTCTCTTTGCACAACATCTTAATCATACACTCCAGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000253A_C01 KCC000253A_c01
         (586 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||A30222 hypothetical D15Kz1 protein - mouse (fragment) gi|57...    41  0.014
ref|XP_343333.1| similar to SMARCD1 protein [Rattus norvegicus]        37  0.20
gb|AAH26783.2| Unknown (protein for IMAGE:4481097) [Mus musculus]      37  0.20
gb|AAH09368.2| SMARCD1 protein [Homo sapiens]                          37  0.20
ref|NP_625773.1| putative secreted protein [Streptomyces coelico...    37  0.27

>pir||A30222 hypothetical D15Kz1 protein - mouse (fragment)
           gi|576884|gb|AAA53377.1| D15Kzl
          Length = 461

 Score = 40.8 bits (94), Expect = 0.014
 Identities = 35/126 (27%), Positives = 52/126 (40%), Gaps = 15/126 (11%)
 Frame = -2

Query: 558 KESKCGQCSSMEAFMGPGVRLGAAPA--LLWSSLSSQSDPPHGVGV*SPPTPHTPQGRDV 385
           + S  G CS      GP VR+G AP   L  S +   + P  G+    P +  TPQG  +
Sbjct: 17  RRSGRGGCSGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGM---LPGSRMTPQGPSM 73

Query: 384 SPPGY-------------ALPSSHSDRAPHQRLEVESRALPDRTGGSPARECARHAV*NR 244
            PPGY              +  S    AP Q  +V+ +A+ +R   +  ++ A   +  R
Sbjct: 74  GPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQR 133

Query: 243 TRVQEP 226
            R   P
Sbjct: 134 IRELVP 139

>ref|XP_343333.1| similar to SMARCD1 protein [Rattus norvegicus]
          Length = 510

 Score = 37.0 bits (84), Expect = 0.20
 Identities = 31/111 (27%), Positives = 47/111 (41%), Gaps = 15/111 (13%)
 Frame = -2

Query: 513 GPGVRLGAAPA--LLWSSLSSQSDPPHGVGV*SPPTPHTPQGRDVSPPGY---------- 370
           GP VR+G AP   L  S +   + P  G+    P +  TPQG  + PPGY          
Sbjct: 35  GPPVRMGPAPGQGLYRSPMPGAAYPRPGM---LPGSRMTPQGPSMGPPGYGGNPSVRPGL 91

Query: 369 ---ALPSSHSDRAPHQRLEVESRALPDRTGGSPARECARHAV*NRTRVQEP 226
               +  S    AP Q  +V+ +A+ +R   +  ++ A   +  R R   P
Sbjct: 92  AQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVP 142

>gb|AAH26783.2| Unknown (protein for IMAGE:4481097) [Mus musculus]
          Length = 497

 Score = 37.0 bits (84), Expect = 0.20
 Identities = 31/111 (27%), Positives = 47/111 (41%), Gaps = 15/111 (13%)
 Frame = -2

Query: 513 GPGVRLGAAPA--LLWSSLSSQSDPPHGVGV*SPPTPHTPQGRDVSPPGY---------- 370
           GP VR+G AP   L  S +   + P  G+    P +  TPQG  + PPGY          
Sbjct: 17  GPPVRMGPAPGQGLYRSPMPGAAYPRPGM---LPGSRMTPQGPSMGPPGYGGNPSVRPGL 73

Query: 369 ---ALPSSHSDRAPHQRLEVESRALPDRTGGSPARECARHAV*NRTRVQEP 226
               +  S    AP Q  +V+ +A+ +R   +  ++ A   +  R R   P
Sbjct: 74  AQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVP 124

>gb|AAH09368.2| SMARCD1 protein [Homo sapiens]
          Length = 515

 Score = 37.0 bits (84), Expect = 0.20
 Identities = 31/111 (27%), Positives = 47/111 (41%), Gaps = 15/111 (13%)
 Frame = -2

Query: 513 GPGVRLGAAPA--LLWSSLSSQSDPPHGVGV*SPPTPHTPQGRDVSPPGY---------- 370
           GP VR+G AP   L  S +   + P  G+    P +  TPQG  + PPGY          
Sbjct: 35  GPPVRMGPAPGQGLYRSPMPGAAYPRPGM---LPGSRMTPQGPSMGPPGYGGNPSVRPGL 91

Query: 369 ---ALPSSHSDRAPHQRLEVESRALPDRTGGSPARECARHAV*NRTRVQEP 226
               +  S    AP Q  +V+ +A+ +R   +  ++ A   +  R R   P
Sbjct: 92  AQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVP 142

>ref|NP_625773.1| putative secreted protein [Streptomyces coelicolor A3(2)]
           gi|8249952|emb|CAB93373.1| putative secreted protein
           [Streptomyces coelicolor A3(2)]
          Length = 295

 Score = 36.6 bits (83), Expect = 0.27
 Identities = 25/73 (34%), Positives = 28/73 (38%), Gaps = 1/73 (1%)
 Frame = -2

Query: 495 GAAPALLWSSLSSQSDPPHGVGV*SPPTPHTPQG-RDVSPPGYALPSSHSDRAPHQRLEV 319
           G  P   WS  +    PP G     PP P  P   R V  PG A P+ H   AP      
Sbjct: 16  GHGPVPGWSPAAHHPGPPQGPAPVPPPAPGYPMAPRPVPHPGPA-PAPHPGPAPAPHQPA 74

Query: 318 ESRALPDRTGGSP 280
            +   PD TG  P
Sbjct: 75  PAPPAPDTTGHVP 87



EST assemble image


clone accession position
1 HC057e02_r AV636286 1 568
2 HC063f05_r AV636743 126 552
3 CM025a11_r AV388072 126 713
4 CS001c04_r AV397938 128 664
5 CL63a03_r AV396517 130 683
6 HCL093d01_r AV644756 132 675
7 MX220e09_r BP090213 133 449
8 MX035c04_r BP087469 133 591
9 HCL038d06_r AV641666 135 381
10 HC040f06_r AV634999 135 666
11 HCL020e09_r AV640685 135 677
12 CL56g09_r AV396119 136 679
13 HC093g08_r AV639010 137 554
14 MX234g08_r BP091165 138 329
15 CL13e10_r AV393929 141 662
16 MX059b07_r BP088386 157 494
17 CL46e03_r AV395647 208 683
18 HCL097b08_r AV645027 248 679
19 HC066a08_r AV636917 353 682




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research