KCC000252A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000252A_C01 KCC000252A_c01
gtcccaccCCGATTATCAAAATGCAGGCGCAGATGCAGCGCAGCGCTAACCGCGCCTTCG
CGGGCCGCAAGGCTTCGTCCCGCATGGTGATGCCCGCTAAGGGCGTCTCGGGCCGCCGCA
GCCGCACCCAGGTCGCCGCGCAGGCTGCCTTCAACAAGGTGCTCATCGCCAACCGCGGCG
AGATTGCTGTGCGCGTCATTCGCGCCTGCAAGGAGCTGGGCCTGCAGACCGTGGCCGTCT
ACTCCACCGCTGACAAGAACTCGCTGCACACGCTGCTGGCCGATGAGGCGGTGTGCATCG
GCGACGCGCCCTCCTCCGAGTCCTACCTCAACATCCCCAACCTGCTGGCGGCCGCCGTCA
GCCGCGGCGCCCAGGCCGTGCACCCCGGCTACGGCTTCCTGTCTGAGCGCGCCGAGTTTG
TGGAGATCTGCACCGACCACGGCCTGGAGTTCATCGGGCCCAAGCCGCAGCAGATCCGGC
TCATGGGCGACAAGTCCACCGCCCGCGACACCATGAAGAAAGCCGGTGTGCCCACCGTGC
CCGGCTCCGAGGGCCTGATCCAGGGCGACGCCGACGCCATTGCCAACGCCCAGCGCATCG
GCTTCCCCGTCATGATCAAGGCCACCGCGGGTGGCGGCGGCCGCGGTATGCGCCTGTGCA
CCAAGGAGGAGGACCTCATGCCCCTGTTCAAGCAGGCCCAGCAGGAGGCCGAGGCCGCGT
TCGGCAACGGCGCCGTGTACATGGAGCGCTTCGTGCAGGACCCCCGCCACATCGAGTTCC
AGGTCCTGGCGGACAAGTACGGCAACGTGGTGCACCTGGGTGAGCGCGACTGCTCGGTGC
AGCGCCGCAACCAGAAGCTGGTGGAGGAGGCGCCCTCGCCCGCCCTCACGCCCGAGGTCC
GCAAGGCCATGGGCGACGCCGCGGTGGCCGCCGCCAAGGCCATTGGCTACGTGGGCGTGG
GCACCATTGAGTTCCTGTGGGAGAAGAAGGGCTTCTACTTCATGGAGATGAACACCCGCA
TCCAGGTGGAGCACCCGGTGACGGAGATGATCACGGGCGTGGACCTGATCCAGGAGCAGA
TCAAGGTGGCCATGGGCGAGCGCCTGACCTTCACGCAGGAGGACATCCAGTTCAAGGGCC
ACGCCATCGAGTGCCGCATCAACGCCGAGGACCCCTTCCAGAACTTCCGCCCCGGCCCCG
GCCGCGTGTCCACCTACCTGGCGCCCGGCGGCCCCCACGTGCGCATGGACAGCCACCTGT
ACCCCGACTACCTGGTCCCCCCGAACTACGACTCCCTGCTGGGCAAGCTGATTGTGTGGG
GCGCAGACCGCCAGCAGGCCATCACCCGCATGAGCCGCGCGCTGGACGAGCTGGTGATCA
CGGGCGTGCCCACCACCGCGCCCTTCCACAAGCTCATCCTGGCCACGGAGGCCTTCAAGG
CCGGCGACGTTGACACGGGCTTCATCATCAAGCACGCTGAGGAGCTGAAGGAGTCGCCGG
GCGTGCCCAAGGTGCGAACCTACCTGTCTGACCTGGCCAAGAGCCGCAAGACCAAGACCG
CCAAGTAAATGCTTGATCCAATACTCGACCTATAACAGCCTCGTGCAGTGTCGTGTGTTG
AGCACTTGAAAGCCATGTTTGGCCCAGGCTGGGAAGAATTGGGAGGCGGTGGATGTGATT
GTGAGGACATCAAGAGCAGCATATCAGGGGCGGGTGCGAGTCGCTGGCCCCTCGCGGGAC
CTGCAGCAAGGTGGCAGGCAGGCAGCCTCGTGAACTTGGTGATAACCATCTTGCGTCGTG
TGCGTTGATCTGTT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000252A_C01 KCC000252A_c01
         (1814 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T07093 acetyl-CoA carboxylase (EC 6.4.1.2) biotin carboxyla...   659  0.0
gb|AAF80469.1|AF163150_1 acetyl-CoA carboxylase [Glycine max]         657  0.0
pir||T06279 acetyl-CoA carboxylase (EC 6.4.1.2), biotin carboxyl...   655  0.0
ref|NP_198386.1| acetyl-CoA carboxylase [Arabidopsis thaliana] g...   654  0.0
gb|AAK25989.1|AF360279_1 putative acetyl-CoA carboxylase [Arabid...   652  0.0

>pir||T07093 acetyl-CoA carboxylase (EC 6.4.1.2) biotin carboxylase chain
            precursor - soybean gi|2253384|gb|AAC02267.1| biotin
            carboxylase precursor [Glycine max]
            gi|8886467|gb|AAF80468.1|AF163149_1 acetyl-CoA
            carboxylase [Glycine max]
          Length = 539

 Score =  659 bits (1699), Expect = 0.0
 Identities = 323/470 (68%), Positives = 387/470 (81%), Gaps = 1/470 (0%)
 Frame = +3

Query: 138  AQAAFNKVLIANRGEIAVRVIRACKELGLQTVAVYSTADKNSLHTLLADEAVCIGDAPSS 317
            A  + +K+LIANRGEIAVRVIR   ELG+  VAVYST DK++LH  LADEAVCIG+APSS
Sbjct: 68   ATCSGDKILIANRGEIAVRVIRTAHELGIPCVAVYSTIDKDALHVKLADEAVCIGEAPSS 127

Query: 318  ESYLNIPNLLAAAVSRGAQAVHPGYGFLSERAEFVEICTDHGLEFIGPKPQQIRLMGDKS 497
            +SYL IPN+L+AA+SR    +HPGYGFL+E A FVE+C +HG+ FIGP P  IR+MGDK+
Sbjct: 128  QSYLLIPNVLSAAISRRCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRVMGDKA 187

Query: 498  TARDTMKKAGVPTVPGSEGLIQGDADAIANAQRIGFPVMIKATAGGGGRGMRLCTKEEDL 677
            TAR+TMKKAGVPTVPGS+GL+Q   +AI  A  IGFPVMIKATAGGGGRGMRL  + ++ 
Sbjct: 188  TARETMKKAGVPTVPGSDGLLQSTEEAIRLANEIGFPVMIKATAGGGGRGMRLAKEPDEF 247

Query: 678  MPLFKQAQQEAEAAFGNGAVYMERFVQDPRHIEFQVLADKYGNVVHLGERDCSVQRRNQK 857
            + L +QA+ EA AAFGN  VY+E+++Q+PRHIEFQVLADKYGNVVH GERDCS+QRRNQK
Sbjct: 248  VKLLQQAKSEAAAAFGNDGVYLEKYIQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQK 307

Query: 858  LVEEAPSPALTPEVRKAMGDAAVAAAKAIGYVGVGTIEFLWEKKG-FYFMEMNTRIQVEH 1034
            L+EEAPSPALTPE+RKAMGDAAVAAA +IGY+GVGTIEFL +++G FYFMEMNTRIQVEH
Sbjct: 308  LLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTIEFLLDERGSFYFMEMNTRIQVEH 367

Query: 1035 PVTEMITGVDLIQEQIKVAMGERLTFTQEDIQFKGHAIECRINAEDPFQNFRPGPGRVST 1214
            PVTEMI+  DLI+EQI+VAMGE+L + QEDI  +GH+IECRINAED F+ FRPGPGR++ 
Sbjct: 368  PVTEMISSTDLIEEQIRVAMGEKLRYKQEDIVLRGHSIECRINAEDAFKGFRPGPGRITA 427

Query: 1215 YLAPGGPHVRMDSHLYPDYLVPPNYDSLLGKLIVWGADRQQAITRMSRALDELVITGVPT 1394
            YL  GGP VRMDSH+YPDY+VPP+YDSLLGKLIVW   R++AI RM RALD+ +ITGVPT
Sbjct: 428  YLPSGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALDDTIITGVPT 487

Query: 1395 TAPFHKLILATEAFKAGDVDTGFIIKHAEELKESPGVPKVRTYLSDLAKS 1544
            T  +HKLIL  E F+ G VDT FI KH EEL   P    +   +++LA S
Sbjct: 488  TIDYHKLILDIEDFRNGKVDTAFIPKHEEELAMPPQKMVLANRVNELAGS 537

>gb|AAF80469.1|AF163150_1 acetyl-CoA carboxylase [Glycine max]
          Length = 539

 Score =  657 bits (1695), Expect = 0.0
 Identities = 322/470 (68%), Positives = 386/470 (81%), Gaps = 1/470 (0%)
 Frame = +3

Query: 138  AQAAFNKVLIANRGEIAVRVIRACKELGLQTVAVYSTADKNSLHTLLADEAVCIGDAPSS 317
            A  + +K+LIANRGEIAVRVIR   ELG+  VAVYST DK++LH  LADEAVCIG+APSS
Sbjct: 68   ATCSGDKILIANRGEIAVRVIRTAHELGIPCVAVYSTIDKDALHVKLADEAVCIGEAPSS 127

Query: 318  ESYLNIPNLLAAAVSRGAQAVHPGYGFLSERAEFVEICTDHGLEFIGPKPQQIRLMGDKS 497
            +SYL IPN+L+AA+SR    +HPGYGFL+E A FVE+C +HG+ FIGP P  IR+MGDK+
Sbjct: 128  QSYLLIPNVLSAAISRRCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRVMGDKA 187

Query: 498  TARDTMKKAGVPTVPGSEGLIQGDADAIANAQRIGFPVMIKATAGGGGRGMRLCTKEEDL 677
            TAR+TMKKAGVPTVPGS+GL+Q   +AI  A  IGFPVMIKATAGGGGRGMRL  +  +L
Sbjct: 188  TARETMKKAGVPTVPGSDGLLQSTEEAIRLANEIGFPVMIKATAGGGGRGMRLAKEPAEL 247

Query: 678  MPLFKQAQQEAEAAFGNGAVYMERFVQDPRHIEFQVLADKYGNVVHLGERDCSVQRRNQK 857
            +   +QA+ EA AAFGN  VY+E+++Q+PRHIEFQVLADKYGNVVH GERDCS+QRRNQK
Sbjct: 248  VKFLQQAKSEAAAAFGNDGVYLEKYIQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQK 307

Query: 858  LVEEAPSPALTPEVRKAMGDAAVAAAKAIGYVGVGTIEFLWEKKG-FYFMEMNTRIQVEH 1034
            L+EEAPSPALTPE+RKAMGDAAVAAA +IGY+GVGT+EFL +++G FYFMEMNTRIQVEH
Sbjct: 308  LLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEH 367

Query: 1035 PVTEMITGVDLIQEQIKVAMGERLTFTQEDIQFKGHAIECRINAEDPFQNFRPGPGRVST 1214
            PVTEMI+  DLI+EQI+VAMGE+L + QEDI  +GH+IECRINAED F+ FRPGPGR++ 
Sbjct: 368  PVTEMISSTDLIEEQIRVAMGEKLRYKQEDIVLRGHSIECRINAEDAFKGFRPGPGRITA 427

Query: 1215 YLAPGGPHVRMDSHLYPDYLVPPNYDSLLGKLIVWGADRQQAITRMSRALDELVITGVPT 1394
            YL  GGP VRMDSH+YPDY+VPP+YDSLLGKLIVW   R++AI RM RALD+ +ITGVPT
Sbjct: 428  YLPSGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALDDTIITGVPT 487

Query: 1395 TAPFHKLILATEAFKAGDVDTGFIIKHAEELKESPGVPKVRTYLSDLAKS 1544
            T  +HKLIL  E F+ G VDT FI KH EEL   P    +   +++LA S
Sbjct: 488  TIDYHKLILDIEDFRNGKVDTAFIPKHEEELAMPPQKMVLANRVNELAGS 537

>pir||T06279 acetyl-CoA carboxylase (EC 6.4.1.2), biotin carboxylase chain
            precursor - soybean gi|3219361|gb|AAC23573.1| biotin
            carboxylase precursor [Glycine max]
          Length = 539

 Score =  655 bits (1691), Expect = 0.0
 Identities = 321/470 (68%), Positives = 385/470 (81%), Gaps = 1/470 (0%)
 Frame = +3

Query: 138  AQAAFNKVLIANRGEIAVRVIRACKELGLQTVAVYSTADKNSLHTLLADEAVCIGDAPSS 317
            A  + +K+LIANRGEIAVRVIR   ELG+  VAVYST DK++LH  LADEAVCIG+APSS
Sbjct: 68   ATCSGDKILIANRGEIAVRVIRTAHELGIPCVAVYSTIDKDALHVKLADEAVCIGEAPSS 127

Query: 318  ESYLNIPNLLAAAVSRGAQAVHPGYGFLSERAEFVEICTDHGLEFIGPKPQQIRLMGDKS 497
            +SYL IPN+L+AA+SR    +HPGYGFL+E A FVE+C +HG+ FIGP P  IR+MGDK+
Sbjct: 128  QSYLLIPNVLSAAISRRCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRVMGDKA 187

Query: 498  TARDTMKKAGVPTVPGSEGLIQGDADAIANAQRIGFPVMIKATAGGGGRGMRLCTKEEDL 677
            TAR+TMKKAGVPTVPGS+GL+Q   +AI  A  IGFPVMIKATAGGGGRGMRL  +  + 
Sbjct: 188  TARETMKKAGVPTVPGSDGLLQSTEEAIRLANEIGFPVMIKATAGGGGRGMRLAKEPAEF 247

Query: 678  MPLFKQAQQEAEAAFGNGAVYMERFVQDPRHIEFQVLADKYGNVVHLGERDCSVQRRNQK 857
            +   +QA+ EA AAFGN  VY+E+++Q+PRHIEFQVLADKYGNVVH GERDCS+QRRNQK
Sbjct: 248  VKFLQQAKSEAAAAFGNDGVYLEKYIQNPRHIEFQVLADKYGNVVHFGERDCSIQRRNQK 307

Query: 858  LVEEAPSPALTPEVRKAMGDAAVAAAKAIGYVGVGTIEFLWEKKG-FYFMEMNTRIQVEH 1034
            L+EEAPSPALTPE+RKAMGDAAVAAA +IGY+GVGT+EFL +++G FYFMEMNTRIQVEH
Sbjct: 308  LLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEH 367

Query: 1035 PVTEMITGVDLIQEQIKVAMGERLTFTQEDIQFKGHAIECRINAEDPFQNFRPGPGRVST 1214
            PVTEMI+  DLI+EQI+VAMGE+L + QEDI  +GH+IECRINAED F+ FRPGPGR++ 
Sbjct: 368  PVTEMISSTDLIEEQIRVAMGEKLRYKQEDIVLRGHSIECRINAEDAFKGFRPGPGRITA 427

Query: 1215 YLAPGGPHVRMDSHLYPDYLVPPNYDSLLGKLIVWGADRQQAITRMSRALDELVITGVPT 1394
            YL  GGP VRMDSH+YPDY+VPP+YDSLLGKLIVW   R++AI RM RALD+ +ITGVPT
Sbjct: 428  YLPSGGPFVRMDSHVYPDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALDDTIITGVPT 487

Query: 1395 TAPFHKLILATEAFKAGDVDTGFIIKHAEELKESPGVPKVRTYLSDLAKS 1544
            T  +HKLIL  E F+ G VDT FI KH EEL   P    +   +++LA S
Sbjct: 488  TIDYHKLILDIEDFRNGKVDTAFIPKHEEELAMPPQKMVLANRVNELAGS 537

>ref|NP_198386.1| acetyl-CoA carboxylase [Arabidopsis thaliana] gi|7438128|pir||T01180
            acetyl-CoA carboxylase (EC 6.4.1.2), biotin carboxylase -
            Arabidopsis thaliana gi|1905876|gb|AAC09008.1| biotin
            carboxylase subunit [Arabidopsis thaliana]
            gi|1916300|gb|AAC09009.1| heteromeric acetyl-CoA
            carboxylase biotin carboxylase subunit [Arabidopsis
            thaliana] gi|3047099|gb|AAC13611.1| Arabidopsis thaliana
            biotin carboxylase subunit (GB:U90879)
            gi|10178099|dbj|BAB11486.1| acetyl-CoA carboxylase,
            biotin carboxylase [Arabidopsis thaliana]
            gi|21554097|gb|AAM63178.1| acetyl-CoA carboxylase
            [Arabidopsis thaliana] gi|23297085|gb|AAN13088.1|
            acetyl-CoA carboxylase [Arabidopsis thaliana]
          Length = 537

 Score =  654 bits (1687), Expect = 0.0
 Identities = 317/456 (69%), Positives = 380/456 (82%), Gaps = 1/456 (0%)
 Frame = +3

Query: 153  NKVLIANRGEIAVRVIRACKELGLQTVAVYSTADKNSLHTLLADEAVCIGDAPSSESYLN 332
            +K+L+ANRGEIAVRVIR   E+G+  VAVYST DK++LH  LADEAVCIG+APS++SYL 
Sbjct: 75   DKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADEAVCIGEAPSNQSYLV 134

Query: 333  IPNLLAAAVSRGAQAVHPGYGFLSERAEFVEICTDHGLEFIGPKPQQIRLMGDKSTARDT 512
            IPN+L+AA+SRG   +HPGYGFLSE A FVE+C DHG+ FIGP P  IR+MGDK+TAR+T
Sbjct: 135  IPNVLSAAISRGCTMLHPGYGFLSENALFVEMCRDHGINFIGPNPDSIRVMGDKATARET 194

Query: 513  MKKAGVPTVPGSEGLIQGDADAIANAQRIGFPVMIKATAGGGGRGMRLCTKEEDLMPLFK 692
            MK AGVPTVPGS+GL+Q   +A+  A  IGFPVMIKATAGGGGRGMRL  +  + + L +
Sbjct: 195  MKNAGVPTVPGSDGLLQSTEEAVRVANEIGFPVMIKATAGGGGRGMRLAKEPGEFVKLLQ 254

Query: 693  QAQQEAEAAFGNGAVYMERFVQDPRHIEFQVLADKYGNVVHLGERDCSVQRRNQKLVEEA 872
            QA+ EA AAFGN   Y+E+FVQ+PRHIEFQVLADK+GNVVH GERDCS+QRRNQKL+EEA
Sbjct: 255  QAKSEAAAAFGNDGCYLEKFVQNPRHIEFQVLADKFGNVVHFGERDCSIQRRNQKLLEEA 314

Query: 873  PSPALTPEVRKAMGDAAVAAAKAIGYVGVGTIEFLWEKKG-FYFMEMNTRIQVEHPVTEM 1049
            PSPALT E+RKAMGDAAVAAA +IGY+GVGT+EFL +++G FYFMEMNTRIQVEHPVTEM
Sbjct: 315  PSPALTAELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEM 374

Query: 1050 ITGVDLIQEQIKVAMGERLTFTQEDIQFKGHAIECRINAEDPFQNFRPGPGRVSTYLAPG 1229
            I  VDLI+EQI+VAMGE+L + QEDI  +GH+IECRINAEDPF+ FRPGPGR+++YL  G
Sbjct: 375  IYSVDLIEEQIRVAMGEKLRYKQEDIVLRGHSIECRINAEDPFKGFRPGPGRITSYLPSG 434

Query: 1230 GPHVRMDSHLYPDYLVPPNYDSLLGKLIVWGADRQQAITRMSRALDELVITGVPTTAPFH 1409
            GP VRMDSH+Y DY+VPP+YDSLLGKLIVW   R++AI RM RAL++ +ITGVPTT  +H
Sbjct: 435  GPFVRMDSHVYSDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTINYH 494

Query: 1410 KLILATEAFKAGDVDTGFIIKHAEELKESPGVPKVR 1517
            KLIL  E FK G VDT FI+KH EEL E   +  V+
Sbjct: 495  KLILDVEDFKNGKVDTAFIVKHEEELAEPQEIVAVK 530

>gb|AAK25989.1|AF360279_1 putative acetyl-CoA carboxylase [Arabidopsis thaliana]
          Length = 537

 Score =  652 bits (1682), Expect = 0.0
 Identities = 316/456 (69%), Positives = 380/456 (83%), Gaps = 1/456 (0%)
 Frame = +3

Query: 153  NKVLIANRGEIAVRVIRACKELGLQTVAVYSTADKNSLHTLLADEAVCIGDAPSSESYLN 332
            +K+L+ANRGEIAVRVIR   E+G+  VAVYST DK++LH  LADEAVCIG+APS++SYL 
Sbjct: 75   DKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADEAVCIGEAPSNQSYLV 134

Query: 333  IPNLLAAAVSRGAQAVHPGYGFLSERAEFVEICTDHGLEFIGPKPQQIRLMGDKSTARDT 512
            IPN+L+AA+SRG   +HPGYGFLSE A FVE+C DHG+ FIGP P  IR+MGDK+TAR+T
Sbjct: 135  IPNVLSAAISRGCTMLHPGYGFLSENALFVEMCRDHGINFIGPNPDSIRVMGDKATARET 194

Query: 513  MKKAGVPTVPGSEGLIQGDADAIANAQRIGFPVMIKATAGGGGRGMRLCTKEEDLMPLFK 692
            MK AGVPTVPGS+GL+Q   +A+  A  IGFPVMIKATAGGGGRGMRL  +  + + L +
Sbjct: 195  MKNAGVPTVPGSDGLLQSTEEAVRVANEIGFPVMIKATAGGGGRGMRLAKEPGEFVKLLQ 254

Query: 693  QAQQEAEAAFGNGAVYMERFVQDPRHIEFQVLADKYGNVVHLGERDCSVQRRNQKLVEEA 872
            QA+ EA AAFGN   Y+E+FVQ+PRHIEFQVLADK+GNVVH GERDCS+QRRNQKL+EEA
Sbjct: 255  QAKSEAAAAFGNDGCYLEKFVQNPRHIEFQVLADKFGNVVHFGERDCSIQRRNQKLLEEA 314

Query: 873  PSPALTPEVRKAMGDAAVAAAKAIGYVGVGTIEFLWEKKG-FYFMEMNTRIQVEHPVTEM 1049
            PSPALT E+RKAMGDAAVAAA +IGY+GVGT+EFL +++G FYFMEMNTRIQVEHPVTEM
Sbjct: 315  PSPALTAELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEM 374

Query: 1050 ITGVDLIQEQIKVAMGERLTFTQEDIQFKGHAIECRINAEDPFQNFRPGPGRVSTYLAPG 1229
            I  VDLI+EQI+VAMGE+L + QEDI  +GH+IECRINAEDPF+ FRPGPGR+++YL  G
Sbjct: 375  IYSVDLIEEQIRVAMGEKLRYKQEDIVLRGHSIECRINAEDPFKGFRPGPGRITSYLPSG 434

Query: 1230 GPHVRMDSHLYPDYLVPPNYDSLLGKLIVWGADRQQAITRMSRALDELVITGVPTTAPFH 1409
            GP VRMDSH+Y +Y+VPP+YDSLLGKLIVW   R++AI RM RAL++ +ITGVPTT  +H
Sbjct: 435  GPFVRMDSHVYSNYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIITGVPTTINYH 494

Query: 1410 KLILATEAFKAGDVDTGFIIKHAEELKESPGVPKVR 1517
            KLIL  E FK G VDT FI+KH EEL E   +  V+
Sbjct: 495  KLILDVEDFKNGKVDTAFIVKHEEELAEPQEIVAVK 530



EST assemble image


clone accession position
1 CL13e09_r AV393922 1 527
2 MXL057g10_r BP096379 9 371
3 CM097h07_r AV393184 234 759
4 LC059h12_r AV623174 659 1190
5 CM080c09_r AV392052 773 1291
6 CM068g08_r AV391080 1001 1600
7 CM089a04_r AV392219 1268 1815
8 CM011d07_r AV386902 1268 1806




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research