KCC000201A_c03
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000201A_C03 KCC000201A_c03
GAAACAACTCACTTACAATACAATAGAACCATTCAAACGCCCAGAAGAATGAGGACGAGT
ATTCCCTGTCGAGGTGGAAGGGTTTCTTCTCGAAATGCTGCCACACAGCGGCTTGCTGTC
GCGCCAGCTGGTCGGAATTGCCCGCGCGGCCGCACCGCAGTTCGCGTGCGGGCTGAGGCA
CCCCGTGATGGATCGCCCACTGCTTTGAAGGAGCCCCCGACCAAGGCCCCGGCGACGGCC
CCTGCGCGCACGCCGCTGGCGCCGCCCAGCCCCGCGCCCGCGCCCGGTCCCCAGTACTTT
CCCAAGCCCGGCGACCCGCAATGGCCGCCCCAGCGCCCCTTTGCCGCCATCGCGCTGGAC
AACCTCTTGGATAGCGTGGTGGACGTGGGGCGCCATCTGGGTCGCATGAACGTGGAGGCA
GACAAGCTGGCGATGCGGCAGCAGGAGCAGCTGGTGCCGGGCGACAACGGGCGCATGCGG
CTGCGCGCCTCCACCAAGCCGGTGGTGCTGGTGCTGGGCAGCGGCTGGGGCGCGCACTCG
CTGATCAAGGTCATTGACACGGACACGTACGACGTGGTGGTTGTGTCCCCCCGCAACCAC
TTCCTGTTCACGCCCATGCT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000201A_C03 KCC000201A_c03
         (620 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAA07265.1| alternative NADH-dehydrogenase [Yarrowia lipolyt...    63  4e-09
ref|NP_013586.1| NADH dehydrogenase (ubiquinone); Ndi1p [Sacchar...    61  1e-08
emb|CAB77710.2| NADH dehydrogenase [Candida albicans]                  61  1e-08
ref|NP_180560.1| NADH dehydrogenase family [Arabidopsis thaliana...    60  2e-08
ref|XP_331372.1| hypothetical protein [Neurospora crassa] gi|289...    60  2e-08

>emb|CAA07265.1| alternative NADH-dehydrogenase [Yarrowia lipolytica]
          Length = 582

 Score = 62.8 bits (151), Expect = 4e-09
 Identities = 47/136 (34%), Positives = 67/136 (48%), Gaps = 4/136 (2%)
 Frame = +1

Query: 223 KAPATAPARTPLAPPSPAPAPGP-QYFPKPGDPQWPPQRPF---AAIALDNLLDSVVDVG 390
           K   TAPA  P      A   G  Q  PKP D   P ++ F    ++     L ++  +G
Sbjct: 32  KIEGTAPAGLPKEVKQTAGHQGHHQEIPKP-DENHPRRKKFHFWRSLWRLTYLSAIASLG 90

Query: 391 RHLGRMNVEADKLAMRQQEQLVPGDNGRMRLRASTKPVVLVLGSGWGAHSLIKVIDTDTY 570
               R+ V      +R     +P D         +K  ++VLGSGWG+ S +K +DT  Y
Sbjct: 91  YIGYRIYV------IRNPSDQLPAD--------PSKKTLVVLGSGWGSVSFLKKLDTSNY 136

Query: 571 DVVVVSPRNHFLFTPM 618
           +V+VVSPRN+FLFTP+
Sbjct: 137 NVIVVSPRNYFLFTPL 152

>ref|NP_013586.1| NADH dehydrogenase (ubiquinone); Ndi1p [Saccharomyces cerevisiae]
           gi|417349|sp|P32340|NDI1_YEAST Rotenone-insensitive
           NADH-ubiquinone oxidoreductase, mitochondrial precursor
           (Internal NADH dehydrogenase) gi|283215|pir||S26704
           NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain NDI1
           - yeast (Saccharomyces cerevisiae)
           gi|805022|emb|CAA89160.1| Ndi1p [Saccharomyces
           cerevisiae]
          Length = 513

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 27/43 (62%), Positives = 35/43 (80%)
 Frame = +1

Query: 490 STKPVVLVLGSGWGAHSLIKVIDTDTYDVVVVSPRNHFLFTPM 618
           S KP VL+LGSGWGA S +K IDT  Y+V ++SPR++FLFTP+
Sbjct: 51  SDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPL 93

>emb|CAB77710.2| NADH dehydrogenase [Candida albicans]
          Length = 574

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 26/41 (63%), Positives = 35/41 (84%)
 Frame = +1

Query: 496 KPVVLVLGSGWGAHSLIKVIDTDTYDVVVVSPRNHFLFTPM 618
           K  +++LGSGWGA SL+K +DT  Y+VV+VSPRN+FLFTP+
Sbjct: 99  KKTLVILGSGWGAISLLKNLDTTLYNVVIVSPRNYFLFTPL 139

>ref|NP_180560.1| NADH dehydrogenase family [Arabidopsis thaliana]
           gi|7432659|pir||T02486 hypothetical protein At2g29990
           [imported] - Arabidopsis thaliana
           gi|3420052|gb|AAC31853.1| putative NADH dehydrogenase
           (ubiquinone oxidoreductase) [Arabidopsis thaliana]
          Length = 508

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 28/45 (62%), Positives = 33/45 (73%)
 Frame = +1

Query: 484 RASTKPVVLVLGSGWGAHSLIKVIDTDTYDVVVVSPRNHFLFTPM 618
           R   KP V+VLGSGW    L+K IDT+ YDVV VSPRNH +FTP+
Sbjct: 67  REGEKPRVVVLGSGWAGCRLMKGIDTNLYDVVCVSPRNHMVFTPL 111

>ref|XP_331372.1| hypothetical protein [Neurospora crassa] gi|28920404|gb|EAA29772.1|
           hypothetical protein [Neurospora crassa]
          Length = 577

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 24/42 (57%), Positives = 37/42 (87%)
 Frame = +1

Query: 493 TKPVVLVLGSGWGAHSLIKVIDTDTYDVVVVSPRNHFLFTPM 618
           +K  ++VLG+GWG+ SL+K +DT+ Y+V+V+SPRN+FLFTP+
Sbjct: 111 SKKTLVVLGTGWGSVSLLKKLDTEHYNVIVISPRNYFLFTPL 152



EST assemble image


clone accession position
1 MXL093b08_r BP098429 1 469
2 LCL084h12_r AV630835 44 602
3 MXL078h05_r BP097640 44 450
4 LCL003e01_r AV626165 48 302
5 LCL074g06_r AV630172 51 521
6 MXL044a08_r BP095573 51 413
7 LCL014g12_r AV626750 51 566
8 LCL029e06_r AV627614 51 602
9 MXL027g02_r BP094701 51 343
10 HCL046g08_r AV642170 51 598
11 LCL049e09_r AV628958 53 244
12 LCL087f10_r AV631018 53 491
13 CL52a07_r AV395839 53 600
14 LCL059e03_r AV629476 54 499
15 LCL003b06_r AV626147 54 244
16 LCL030e08_r AV627685 54 359
17 MXL082e06_r BP097861 55 485
18 HCL057d03_r AV642758 56 576
19 LCL055a10_r AV629239 56 566
20 LCL013b02_r AV626656 58 606
21 LCL100f07_r AV631839 70 579
22 CL67e09_r AV396703 72 239
23 HCL002g12_r AV639671 72 625
24 LCL044e08_r AV628613 74 350
25 MXL050h02_r BP096001 74 555
26 MXL005f07_r BP093250 75 618
27 HCL030a07_r AV641221 76 533
28 HCL006c07_r AV639862 80 474
29 MXL025c02_r BP094580 261 677




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research