KCC000200A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000200A_C01 KCC000200A_c01
gcGTCCCCACAACCAGGACAGCCTACTTCTTGACCTTATTAATAAGTCGCTGCGTGTCGC
GACTGACCATTTTGGCCCGGACTTGCGTGCTTGTGATTTGTGCTTCGACTAGATCCGCGG
GCACCAAGGGACGCGGACAGCTGATAGTCAAGAACTAGATCCTCTGGGAGCGTCTGGGGC
TGTCCCCGCTGCTCGCCAAGGAAATGAAGTCTCTCTGCCATGAGCTCGCTGGCCCCAGCG
TTACTGGGTGCGGCCGGCGAAGCCTCCGGAAGGCTTTCAGCGGTGCCAAGATTGCGCAGG
TCTCTCGCCCCGCTGTGCTTAACAGCGTGCAGCGCCAACAGCGTCTCGCCTGTTCTGCCG
TGGCCGAGCTCTCCGCTGCTGAGCTGCGCGCCATGAAGGTGTCTGAGGAGGACTCCAAGG
GCTTCGATGCGGATGTGTCGACCCGCCTGGCCCGCTCGTACCCTCTGGCGGCCGTGGTGG
GCCAGGACAACATCAAGCAGGCGCTGCTGCTGGGCGCCGTGGACACCGGGCTGGGCGGCA
TCGCCATCGCCGGTCGCCGCGGTACCGCCAAGTCCATCATGGCTCGCGGCCTGCACGCTC
TGCTGCCGCCCATTGAGGTGGTGGAGGGCAGCATCTGCAACGCCGACCCCGAGGACCCCC
GCTCCTGGGAGGCTGGCCTGGCTGAGAAGTATGCGGGCGGCCCTGTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000200A_C01 KCC000200A_c01
         (707 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAP73850.1| putative magnesium chelatase subunit chlD [Oryza ...   116  3e-25
sp|O22437|CHLD_PEA Magnesium-chelatase subunit chlD, chloroplast...   116  4e-25
sp|O24133|CHLD_TOBAC Magnesium-chelatase subunit chlD, chloropla...   114  1e-24
ref|ZP_00109706.1| COG1239: Mg-chelatase subunit ChlI [Nostoc pu...   113  3e-24
gb|AAD52031.1|AF083555_1 magnesium-chelatase subunit CHLD precur...   113  3e-24

>gb|AAP73850.1| putative magnesium chelatase subunit chlD [Oryza sativa (japonica
           cultivar-group)]
          Length = 745

 Score =  116 bits (291), Expect = 3e-25
 Identities = 56/77 (72%), Positives = 65/77 (83%)
 Frame = +3

Query: 459 YPLAAVVGQDNIKQALLLGAVDTGLGGIAIAGRRGTAKSIMARGLHALLPPIEVVEGSIC 638
           +PLAAVVGQD IK ALLLGA+D  +GGIAI+G+RGTAK++MARGLHA+LPPIEVV GSI 
Sbjct: 79  FPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAKTVMARGLHAMLPPIEVVVGSIA 138

Query: 639 NADPEDPRSWEAGLAEK 689
           NADP  P  WE GLA +
Sbjct: 139 NADPNYPEEWEEGLANQ 155

>sp|O22437|CHLD_PEA Magnesium-chelatase subunit chlD, chloroplast precursor
           (Mg-protoporphyrin IX chelatase) (Mg-chelatase subunit
           D) gi|7488839|pir||T06249 protoporphyrin IX magnesium
           chelatase (EC 4.99.1.-) D chain - garden pea
           gi|2318117|gb|AAB72194.1| Mg-chelatase subunit D [Pisum
           sativum]
          Length = 754

 Score =  116 bits (290), Expect = 4e-25
 Identities = 57/86 (66%), Positives = 68/86 (78%)
 Frame = +3

Query: 432 DVSTRLARSYPLAAVVGQDNIKQALLLGAVDTGLGGIAIAGRRGTAKSIMARGLHALLPP 611
           D S    + +PLAAV+GQD IK ALLLGA D  +GGIAI+GRRGTAK+IMARG+HA+LPP
Sbjct: 68  DASNYGRQYFPLAAVIGQDAIKTALLLGATDPRIGGIAISGRRGTAKTIMARGMHAILPP 127

Query: 612 IEVVEGSICNADPEDPRSWEAGLAEK 689
           IEVV+GSI NADP  P  WE GL ++
Sbjct: 128 IEVVQGSIANADPSCPEEWEDGLYKR 153

>sp|O24133|CHLD_TOBAC Magnesium-chelatase subunit chlD, chloroplast precursor
           (Mg-protoporphyrin IX chelatase) (Mg-chelatase subunit
           D) gi|7489191|pir||T02925 protoporphyrin IX magnesium
           chelatase (EC 4.99.1.-) chain chlD - common tobacco
           gi|2239151|emb|CAA71128.1| CHLD magnesium chelatase
           subunit [Nicotiana tabacum]
          Length = 758

 Score =  114 bits (285), Expect = 1e-24
 Identities = 54/77 (70%), Positives = 65/77 (84%)
 Frame = +3

Query: 459 YPLAAVVGQDNIKQALLLGAVDTGLGGIAIAGRRGTAKSIMARGLHALLPPIEVVEGSIC 638
           +PLAAV+GQD IK ALLLGA+D  +GGIAI G+RGTAK++MARGLHA+LPPIEVV GS+ 
Sbjct: 80  FPLAAVIGQDAIKTALLLGAIDREIGGIAICGKRGTAKTLMARGLHAILPPIEVVVGSMA 139

Query: 639 NADPEDPRSWEAGLAEK 689
           NADP  P  WE GLA++
Sbjct: 140 NADPNCPDEWEDGLADR 156

>ref|ZP_00109706.1| COG1239: Mg-chelatase subunit ChlI [Nostoc punctiforme]
          Length = 676

 Score =  113 bits (283), Expect = 3e-24
 Identities = 55/80 (68%), Positives = 64/80 (79%)
 Frame = +3

Query: 456 SYPLAAVVGQDNIKQALLLGAVDTGLGGIAIAGRRGTAKSIMARGLHALLPPIEVVEGSI 635
           ++PL AVVGQ+ IK ALLL AVD GLGG+AIAGRRGTAKS+MAR +HALLPPIEVV+GSI
Sbjct: 12  AFPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSI 71

Query: 636 CNADPEDPRSWEAGLAEKYA 695
            N DP  P  W+  L  +YA
Sbjct: 72  SNCDPNHPEEWDDQLLAEYA 91

>gb|AAD52031.1|AF083555_1 magnesium-chelatase subunit CHLD precursor [Arabidopsis thaliana]
          Length = 726

 Score =  113 bits (282), Expect = 3e-24
 Identities = 61/116 (52%), Positives = 77/116 (65%)
 Frame = +3

Query: 342 RLACSAVAELSAAELRAMKVSEEDSKGFDADVSTRLARSYPLAAVVGQDNIKQALLLGAV 521
           R    A A  +      +  S  D++  + D ++   + +PLAAVVGQ+ IK ALLLGAV
Sbjct: 14  RFTVRASANATVESPNGVPASTSDTET-ETDTTSYGRQFFPLAAVVGQEGIKTALLLGAV 72

Query: 522 DTGLGGIAIAGRRGTAKSIMARGLHALLPPIEVVEGSICNADPEDPRSWEAGLAEK 689
           D  +GGIAI+GRRGTAK++MARGLH +LPPIEVV GSI NADP  P  WE  L E+
Sbjct: 73  DREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPNEWEDDLDER 128



EST assemble image


clone accession position
1 LCL057h10_r AV629394 1 252
2 HCL025f10_r AV640980 3 438
3 CL09h05_r AV393717 9 482
4 MXL087c01_r BP098108 258 707




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research