KCC000198A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000198A_C02 KCC000198A_c02
GAAGCGAAAAACGGGAGACTTACTTGAGGCTCCATGCACTCGCGTTTCGATTTAGGGGCC
CGCGTCTACACTCATCGAGGCTTCATTCTGCTGTAGTCGTTAAAGCCACACGGTAACTTG
TCTATACCAGTACTTTTGCGAGTTACCCCTGTGACACTTTGTCGCTTCTTGAATCTTACT
CCTCCCAGAGCCAGTTGCTCTAGGACCCCGCACAAATGGCTGATGCCAGCACGTCCGCGG
ACGCTAGCAAGAAGGATGCCAACAAGAAGGACTTCAGCACGGCCATTATGGACCGTAAGA
AGAGCCCCAACCGCCTCATTGTGGAGGAGGCGGTGAACGACGACAACTCGGTGGTCGCCC
TGCACCCTAAGACCATGGAGAAGCTGCAGCTGTTCCGCGGCGACACGGTGCTCCTGAAGG
GCAAGAAGCGGAAGGACACGGTGTGCATCGTGCTGTCGGATGACACGGTTGATGAGAACA
AGATCCGTATGAACAAGGTTGTTCGCAAGAACCTTCGTGTGCGCCTGGCGGACATCGTGT
CCGTGCACCAGTGCACCGACGTCAAGTACGGCAAGCGCATCCACGTGCTGCCCATCGACG
ACACCATTGAGGGCATCAGCGGCAACCTTTTTGACGCCTACCTGAAGCCCTACTTCCTGG
AGGCCTACCGCCCCGTGCGCAAGGGCGACACCTTCCTGGCCCGCGGCGGCATGCGCAGCG
TGGAGTTCAAGGTGGTGGAGACCGACCCCGCCGAGTACTGCATTGTGGCGCCCGACACCG
AGATCTTCTGCGAGGGCGAGCCCATCAAGCGCGAGGACGAGGAGAAGCTGGACGAGGTGG
GCTACGACGACATTGGCGGTGTGCTGCAAGCAGCTGGCCCAGATCCGTGAGCTGGTGGAG
CTGCCGCTGCGCCACCCGCAGCTGTTCAAGACCATTGGTGTCAAGCCGCCCAAGGGCATC
CTGCTGTACGGCCCGCCCGGCAGTGGCAAGACGCTGATTGCCCGTGCCGTGGCCAATGAG
ACGGGCGCCTTCTTCGTGGTGGTCAACGGCCCGGAGATCATGTCCAAGCTGGCGGGAGAG
TCGGAGAGCAACCTGCGCAAGGTGTTCCAGGAGGCTGAGAAGAACGCGCCCTCCATCATC
TTCATCGATGAGGTGGACTCCATCGCGCCCAAGCGTGAGAAGACCCAGGGTGAGGTGGAG
CGCCGCATCGTGTCGCAGCTGCTGACGCTGATGGACGGCCTGAAGAGCCGCGCGCACGTG
ATCGTGATCGCCGCCACCAACCGCCCCAACTCCATCGACCCCGCGCTGCGCCGCTTCGGC
CGCTTCGACCGCGAGATTGACATCGGCGTGCCGGATGAGACCGGCCGCCTGGAGGTCATG
CGCATCCACACCAAGAACATGAAGCTGGACGAGGACGTGAACCTGGAGGCCATCAGCCGC
GACACGCACGGCTACGTGGGCGCCGACCTTGCGGCGCTGTGCACGGAGGCGGCGCTGCAG
TGCATCCGCGAGAAGATGGACGTGATTGACCTGGAGGACGAGCAGATTGACGCCGAGGTG
CTCAACAGCATGGCGGTCACGCAGGACCACTTCAAGACCGCCCTGGGCATGAGCAACCCC
AGCGCGCTGCGCGAGACGGTGGTGGAGGTGCCCAACGTGAGCTGGGACGCCATCGGTGGC
CTGGAGAACGTCAAGCGCGAGCTGCAGGAGCTGATCCAGTACCCGGTGGAGCACCCCGAG
AAGTTTGAGAAGTTCGGCATGTCGCCCTCCAAGGGTGTGTTGTTCTACGGCCCGCCCGGC
TGCGGCAAGACGCTGCTGGCCAAGGCCATCGCCAACGAGTGCCA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000198A_C02 KCC000198A_c02
         (1844 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P54774|CC48_SOYBN Cell division cycle protein 48 homolog (Val...   599  0.0
ref|NP_187595.1| transitional endoplasmic reticulum ATPase -rela...   596  0.0
ref|NP_190891.1| CDC48 - like protein [Arabidopsis thaliana] gi|...   598  0.0
ref|NP_568114.1| transitional endoplasmic reticulum ATPase -rela...   595  0.0
pir||T48355 transitional endoplasmic reticulum ATPase - Arabidop...   595  0.0

>sp|P54774|CC48_SOYBN Cell division cycle protein 48 homolog (Valosin containing protein
            homolog) (VCP) gi|7435757|pir||T06409 valosin-containing
            protein - soybean gi|862480|gb|AAA80587.1|
            valosin-containing protein
          Length = 807

 Score =  599 bits (1544), Expect(2) = 0.0
 Identities = 298/325 (91%), Positives = 312/325 (95%)
 Frame = +1

Query: 868  KQLAQIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVN 1047
            KQ+AQIRELVELPLRHPQLFK+IGVKPPKGILLYGPPGSGKTLIARAVANETGAFF  +N
Sbjct: 215  KQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCIN 274

Query: 1048 GPEIMSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQGEVERRIVSQLLT 1227
            GPEIMSKLAGESESNLRK F+EAEKNAPSIIFIDE+DSIAPKREKT GEVERRIVSQLLT
Sbjct: 275  GPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLT 334

Query: 1228 LMDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKL 1407
            LMDGLKSRAHVIVI ATNRPNSIDPALRRFGRFDREIDIGVPDE GRLEV+RIHTKNMKL
Sbjct: 335  LMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKL 394

Query: 1408 DEDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQIDAEVLNSMAVTQD 1587
             +DV+LE I++DTHGYVGADLAALCTEAALQCIREKMDVIDLEDE IDAEVLNSMAVT +
Sbjct: 395  SDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNE 454

Query: 1588 HFKTALGMSNPSALRETVVEVPNVSWDAIGGLENVKRELQELIQYPVEHPEKFEKFGMSP 1767
            HF+TALG SNPSALRETVVEVPNVSW+ IGGLENVKRELQE +QYPVEHPEKFEKFGMSP
Sbjct: 455  HFQTALGTSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSP 514

Query: 1768 SKGVLFYGPPGCGKTLLAKAIANEC 1842
            SKGVLFYGPPGCGKTLLAKAIANEC
Sbjct: 515  SKGVLFYGPPGCGKTLLAKAIANEC 539

 Score =  365 bits (937), Expect(2) = 0.0
 Identities = 169/212 (79%), Positives = 194/212 (90%)
 Frame = +3

Query: 228 STSADASKKDANKKDFSTAIMDRKKSPNRLIVEEAVNDDNSVVALHPKTMEKLQLFRGDT 407
           S   ++S   + KKDFSTAI++RKKSPNRL+V+EAVNDDNSVV +HP+TMEKLQLFRGDT
Sbjct: 2   SQQGESSDPKSGKKDFSTAILERKKSPNRLVVDEAVNDDNSVVTMHPQTMEKLQLFRGDT 61

Query: 408 VLLKGKKRKDTVCIVLSDDTVDENKIRMNKVVRKNLRVRLADIVSVHQCTDVKYGKRIHV 587
           +L+KGKKRKDT+CI L+D+  +E KIRMNKVVR NLRVRL D+VSVHQC DVKYGKR+H+
Sbjct: 62  ILIKGKKRKDTICIALADENCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHI 121

Query: 588 LPIDDTIEGISGNLFDAYLKPYFLEAYRPVRKGDTFLARGGMRSVEFKVVETDPAEYCIV 767
           LPIDDTIEG++GNLFDA+LKPYFLEAYRPVRKGD FL RGGMRSVEFKVVETDP EYC+V
Sbjct: 122 LPIDDTIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVVETDPGEYCVV 181

Query: 768 APDTEIFCEGEPIKREDEEKLDEVGYDDIGGV 863
           APDTEIFCEGEP+KREDEE+LDEVGYDD+GGV
Sbjct: 182 APDTEIFCEGEPLKREDEERLDEVGYDDVGGV 213

 Score =  199 bits (507), Expect = 1e-49
 Identities = 101/239 (42%), Positives = 159/239 (66%), Gaps = 3/239 (1%)
 Frame = +1

Query: 880  QIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVNGPEI 1059
            +++E V+ P+ HP+ F+  G+ P KG+L YGPPG GKTL+A+A+ANE  A F+ V GPE+
Sbjct: 492  ELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 551

Query: 1060 MSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQGE---VERRIVSQLLTL 1230
            ++   GESE+N+R++F +A ++AP ++F DE+DSIA +R  + G+      R+++QLLT 
Sbjct: 552  LTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTE 611

Query: 1231 MDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKLD 1410
            MDG+ ++  V +I ATNRP+ IDPAL R GR D+ I I +PDE  R ++ +   +   + 
Sbjct: 612  MDGMSAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEDSRHQIFKACLRKSPIA 671

Query: 1411 EDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQIDAEVLNSMAVTQD 1587
            ++V+L A++R T G+ GAD+  +C  A    IRE ++  D+E E+   E  N  A+ +D
Sbjct: 672  KNVDLRALARHTQGFSGADITEICQRACKYAIRENIEK-DIERERKSRE--NPEAMDED 727

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 31/70 (44%), Positives = 48/70 (68%)
 Frame = +1

Query: 1630 RETVVEVPNVSWDAIGGLENVKRELQELIQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGK 1809
            RE    +  V +D +GG+     +++EL++ P+ HP+ F+  G+ P KG+L YGPPG GK
Sbjct: 196  REDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGK 255

Query: 1810 TLLAKAIANE 1839
            TL+A+A+ANE
Sbjct: 256  TLIARAVANE 265

>ref|NP_187595.1| transitional endoplasmic reticulum ATPase -related [Arabidopsis
            thaliana] gi|1705677|sp|P54609|C48A_ARATH Cell division
            control protein 48 homolog A (AtCDC48a)
            gi|2118115|pir||S60112 transitional endoplasmic reticulum
            ATPase - Arabidopsis thaliana gi|1019904|gb|AAC49120.1|
            cell division cycle protein
            gi|6681343|gb|AAF23260.1|AC015985_18 putative
            transitional endoplasmic reticulum ATPase [Arabidopsis
            thaliana] gi|17473551|gb|AAL38252.1| putative
            transitional endoplasmic reticulum ATPase [Arabidopsis
            thaliana] gi|20453130|gb|AAM19807.1| AT3g09840/F8A24_11
            [Arabidopsis thaliana]
          Length = 809

 Score =  596 bits (1537), Expect(2) = 0.0
 Identities = 297/325 (91%), Positives = 311/325 (95%)
 Frame = +1

Query: 868  KQLAQIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVN 1047
            KQ+AQIRELVELPLRHPQLFK+IGVKPPKGILLYGPPGSGKTLIARAVANETGAFF  +N
Sbjct: 214  KQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCIN 273

Query: 1048 GPEIMSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQGEVERRIVSQLLT 1227
            GPEIMSKLAGESESNLRK F+EAEKNAPSIIFIDE+DSIAPKREKT GEVERRIVSQLLT
Sbjct: 274  GPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLT 333

Query: 1228 LMDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKL 1407
            LMDGLKSRAHVIV+ ATNRPNSIDPALRRFGRFDREIDIGVPDE GRLEV+RIHTKNMKL
Sbjct: 334  LMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKL 393

Query: 1408 DEDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQIDAEVLNSMAVTQD 1587
             EDV+LE IS+DTHGYVGADLAALCTEAALQCIREKMDVIDLED+ IDAE+LNSMAVT +
Sbjct: 394  AEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDDSIDAEILNSMAVTNE 453

Query: 1588 HFKTALGMSNPSALRETVVEVPNVSWDAIGGLENVKRELQELIQYPVEHPEKFEKFGMSP 1767
            HF TALG SNPSALRETVVEVPNVSW+ IGGLENVKRELQE +QYPVEHPEKFEKFGMSP
Sbjct: 454  HFHTALGNSNPSALRETVVEVPNVSWNDIGGLENVKRELQETVQYPVEHPEKFEKFGMSP 513

Query: 1768 SKGVLFYGPPGCGKTLLAKAIANEC 1842
            SKGVLFYGPPGCGKTLLAKAIANEC
Sbjct: 514  SKGVLFYGPPGCGKTLLAKAIANEC 538

 Score =  367 bits (943), Expect(2) = 0.0
 Identities = 170/212 (80%), Positives = 198/212 (93%)
 Frame = +3

Query: 228 STSADASKKDANKKDFSTAIMDRKKSPNRLIVEEAVNDDNSVVALHPKTMEKLQLFRGDT 407
           ST A++S   + KKDFSTAI++RKKSPNRL+V+EA+NDDNSVV+LHP TMEKLQLFRGDT
Sbjct: 2   STPAESSDSKS-KKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDT 60

Query: 408 VLLKGKKRKDTVCIVLSDDTVDENKIRMNKVVRKNLRVRLADIVSVHQCTDVKYGKRIHV 587
           +L+KGKKRKDTVCI L+D+T +E KIRMNKVVR NLRVRL D++SVHQC DVKYGKR+H+
Sbjct: 61  ILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHI 120

Query: 588 LPIDDTIEGISGNLFDAYLKPYFLEAYRPVRKGDTFLARGGMRSVEFKVVETDPAEYCIV 767
           LP+DDT+EG++GNLFDAYLKPYFLEAYRPVRKGD FL RGGMRSVEFKV+ETDPAEYC+V
Sbjct: 121 LPVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVV 180

Query: 768 APDTEIFCEGEPIKREDEEKLDEVGYDDIGGV 863
           APDTEIFCEGEP+KREDEE+LD+VGYDD+GGV
Sbjct: 181 APDTEIFCEGEPVKREDEERLDDVGYDDVGGV 212

 Score =  194 bits (494), Expect = 3e-48
 Identities = 100/240 (41%), Positives = 157/240 (64%), Gaps = 4/240 (1%)
 Frame = +1

Query: 880  QIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVNGPEI 1059
            +++E V+ P+ HP+ F+  G+ P KG+L YGPPG GKTL+A+A+ANE  A F+ V GPE+
Sbjct: 491  ELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 550

Query: 1060 MSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQ----GEVERRIVSQLLT 1227
            ++   GESE+N+R++F +A ++AP ++F DE+DSIA +R        G    R+++QLLT
Sbjct: 551  LTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGGGSGGDGGGAADRVLNQLLT 610

Query: 1228 LMDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKL 1407
             MDG+ ++  V +I ATNRP+ ID AL R GR D+ I I +PDE  RL + +   +   +
Sbjct: 611  EMDGMNAKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKAALRKSPI 670

Query: 1408 DEDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQIDAEVLNSMAVTQD 1587
             +DV++ A+++ T G+ GAD+  +C  A    IRE ++  D+E E+  +E  N  A+ +D
Sbjct: 671  AKDVDIGALAKYTQGFSGADITEICQRACKYAIRENIEK-DIEKEKRRSE--NPEAMEED 727

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 68/277 (24%), Positives = 122/277 (43%), Gaps = 17/277 (6%)
 Frame = +1

Query: 1060 MSKLAGESESNLRKVFQEA---EKNAPSIIFIDEV----DSIAPKREKTQGEVERRIVSQ 1218
            MS  A  S+S  +K F  A    K +P+ + +DE     +S+      T  +++  +   
Sbjct: 1    MSTPAESSDSKSKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQ--LFRG 58

Query: 1219 LLTLMDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHT-K 1395
               L+ G K +  V +  A          + +  R +  + +G        +V+ +H   
Sbjct: 59   DTILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLG--------DVISVHQCP 110

Query: 1396 NMKLDEDVNLEAISRDTHGYVGADLAALCTEAALQCIR--EKMDVI-------DLEDEQI 1548
            ++K  + V++  +     G  G    A      L+  R   K D+         +E + I
Sbjct: 111  DVKYGKRVHILPVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVI 170

Query: 1549 DAEVLNSMAVTQDHFKTALGMSNPSALRETVVEVPNVSWDAIGGLENVKRELQELIQYPV 1728
            + +      V  D   T +        RE    + +V +D +GG+     +++EL++ P+
Sbjct: 171  ETDPAEYCVVAPD---TEIFCEGEPVKREDEERLDDVGYDDVGGVRKQMAQIRELVELPL 227

Query: 1729 EHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANE 1839
             HP+ F+  G+ P KG+L YGPPG GKTL+A+A+ANE
Sbjct: 228  RHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANE 264

>ref|NP_190891.1| CDC48 - like protein [Arabidopsis thaliana]
            gi|28201772|sp|Q9SCN8|C48D_ARATH Putative cell division
            control protein 48 homolog D (AtCDC48d) (Transitional
            endoplasmic reticulum ATPase D) gi|11265359|pir||T46169
            CDC48-like protein - Arabidopsis thaliana
            gi|6630743|emb|CAB64226.1| CDC48-like protein
            [Arabidopsis thaliana]
          Length = 815

 Score =  598 bits (1541), Expect(2) = 0.0
 Identities = 296/325 (91%), Positives = 313/325 (96%)
 Frame = +1

Query: 868  KQLAQIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVN 1047
            KQ+AQIRELVELPLRHPQLFK+IGVKPPKGILLYGPPGSGKTLIARAVANETGAFF  +N
Sbjct: 215  KQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCIN 274

Query: 1048 GPEIMSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQGEVERRIVSQLLT 1227
            GPEIMSKLAGESESNLRK F+EAEKNAPSIIFIDE+DSIAPKREKT GEVERRIVSQLLT
Sbjct: 275  GPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLT 334

Query: 1228 LMDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKL 1407
            LMDGLKSRAHVIV+ ATNRPNSIDPALRRFGRFDREIDIGVPDE GRLEV+RIHTKNMKL
Sbjct: 335  LMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKL 394

Query: 1408 DEDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQIDAEVLNSMAVTQD 1587
             EDV+LE +S+DTHGYVGADLAALCTEAALQCIREKMDVIDL+DE+IDAE+LNSMAV+ D
Sbjct: 395  AEDVDLERVSKDTHGYVGADLAALCTEAALQCIREKMDVIDLDDEEIDAEILNSMAVSND 454

Query: 1588 HFKTALGMSNPSALRETVVEVPNVSWDAIGGLENVKRELQELIQYPVEHPEKFEKFGMSP 1767
            HF+TALG SNPSALRETVVEVPNVSW+ IGGLENVKRELQE +QYPVEHPEKFEKFGMSP
Sbjct: 455  HFQTALGNSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSP 514

Query: 1768 SKGVLFYGPPGCGKTLLAKAIANEC 1842
            SKGVLFYGPPGCGKTLLAKAIANEC
Sbjct: 515  SKGVLFYGPPGCGKTLLAKAIANEC 539

 Score =  365 bits (936), Expect(2) = 0.0
 Identities = 167/212 (78%), Positives = 194/212 (90%)
 Frame = +3

Query: 228 STSADASKKDANKKDFSTAIMDRKKSPNRLIVEEAVNDDNSVVALHPKTMEKLQLFRGDT 407
           +  A++S     KKDFSTAI+++KK+ NRL+V+EA+NDDNSVV+LHP TMEKLQLFRGDT
Sbjct: 2   ANQAESSDSKGTKKDFSTAILEKKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGDT 61

Query: 408 VLLKGKKRKDTVCIVLSDDTVDENKIRMNKVVRKNLRVRLADIVSVHQCTDVKYGKRIHV 587
           +L+KGKKRKDTVCI L+D+T DE KIRMNKVVR NLRVRL D++SVHQC DVKYG R+H+
Sbjct: 62  ILIKGKKRKDTVCIALADETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVHI 121

Query: 588 LPIDDTIEGISGNLFDAYLKPYFLEAYRPVRKGDTFLARGGMRSVEFKVVETDPAEYCIV 767
           LP+DDTIEG+SGN+FDAYLKPYFLEAYRPVRKGD FL RGGMRS+EFKV+ETDPAEYC+V
Sbjct: 122 LPLDDTIEGVSGNIFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSIEFKVIETDPAEYCVV 181

Query: 768 APDTEIFCEGEPIKREDEEKLDEVGYDDIGGV 863
           APDTEIFCEGEPIKREDEE+LDEVGYDD+GGV
Sbjct: 182 APDTEIFCEGEPIKREDEERLDEVGYDDVGGV 213

 Score =  199 bits (506), Expect = 1e-49
 Identities = 98/234 (41%), Positives = 157/234 (66%), Gaps = 3/234 (1%)
 Frame = +1

Query: 880  QIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVNGPEI 1059
            +++E V+ P+ HP+ F+  G+ P KG+L YGPPG GKTL+A+A+ANE  A F+ + GPE+
Sbjct: 492  ELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPEL 551

Query: 1060 MSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQGE---VERRIVSQLLTL 1230
            ++   GESE+N+R++F +A ++AP ++F DE+DSIA +R  + G+      R+++QLLT 
Sbjct: 552  LTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSVGDAGGAADRVLNQLLTE 611

Query: 1231 MDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKLD 1410
            MDG+ ++  V +I ATNRP+ IDPAL R GR D+ I I +PDE  R ++ +   +   + 
Sbjct: 612  MDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEESRYQIFKSCLRKSPVA 671

Query: 1411 EDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQIDAEVLNSM 1572
            +DV+L A+++ T G+ GAD+  +C  +    IRE ++  D+E E+  AE   +M
Sbjct: 672  KDVDLRALAKYTQGFSGADITEICQRSCKYAIRENIEK-DIEKERKRAESPEAM 724

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 31/70 (44%), Positives = 48/70 (68%)
 Frame = +1

Query: 1630 RETVVEVPNVSWDAIGGLENVKRELQELIQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGK 1809
            RE    +  V +D +GG+     +++EL++ P+ HP+ F+  G+ P KG+L YGPPG GK
Sbjct: 196  REDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGK 255

Query: 1810 TLLAKAIANE 1839
            TL+A+A+ANE
Sbjct: 256  TLIARAVANE 265

>ref|NP_568114.1| transitional endoplasmic reticulum ATPase -related [Arabidopsis
            thaliana] gi|28201771|sp|Q9LZF6|C48E_ARATH Cell division
            control protein 48 homolog E (AtCDC48e) (Transitional
            endoplasmic reticulum ATPase E)
            gi|26449352|dbj|BAC41803.1| putative transitional
            endoplasmic reticulum ATPase [Arabidopsis thaliana]
            gi|26452166|dbj|BAC43171.1| putative transitional
            endoplasmic reticulum ATPase [Arabidopsis thaliana]
            gi|30102750|gb|AAP21293.1| At5g03340 [Arabidopsis
            thaliana]
          Length = 810

 Score =  595 bits (1534), Expect(2) = 0.0
 Identities = 296/325 (91%), Positives = 311/325 (95%)
 Frame = +1

Query: 868  KQLAQIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVN 1047
            KQ+AQIRELVELPLRHPQLFK+IGVKPPKGILLYGPPGSGKTLIARAVANETGAFF  +N
Sbjct: 214  KQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCIN 273

Query: 1048 GPEIMSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQGEVERRIVSQLLT 1227
            GPEIMSKLAGESESNLRK F+EAEKNAPSIIFIDE+DSIAPKREKT GEVERRIVSQLLT
Sbjct: 274  GPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLT 333

Query: 1228 LMDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKL 1407
            LMDGLKSRAHVIV+ ATNRPNSIDPALRRFGRFDREIDIGVPDE GRLEV+RIHTKNMKL
Sbjct: 334  LMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKL 393

Query: 1408 DEDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQIDAEVLNSMAVTQD 1587
             EDV+LE IS+DTHGYVGADLAALCTEAALQCIREKMDVIDLED+ IDAE+LNSMAV+ +
Sbjct: 394  AEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDDSIDAEILNSMAVSNE 453

Query: 1588 HFKTALGMSNPSALRETVVEVPNVSWDAIGGLENVKRELQELIQYPVEHPEKFEKFGMSP 1767
            HF TALG SNPSALRETVVEVPNVSW+ IGGLENVKRELQE +QYPVEHPEKFEKFGMSP
Sbjct: 454  HFHTALGNSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSP 513

Query: 1768 SKGVLFYGPPGCGKTLLAKAIANEC 1842
            SKGVLFYGPPGCGKTLLAKAIANEC
Sbjct: 514  SKGVLFYGPPGCGKTLLAKAIANEC 538

 Score =  367 bits (942), Expect(2) = 0.0
 Identities = 168/206 (81%), Positives = 192/206 (92%)
 Frame = +3

Query: 246 SKKDANKKDFSTAIMDRKKSPNRLIVEEAVNDDNSVVALHPKTMEKLQLFRGDTVLLKGK 425
           S     KKDFSTAI++RKKSPNRL+V+EA+NDDNSVV+LHP TMEKLQLFRGDT+L+KGK
Sbjct: 7   SSDSKTKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGK 66

Query: 426 KRKDTVCIVLSDDTVDENKIRMNKVVRKNLRVRLADIVSVHQCTDVKYGKRIHVLPIDDT 605
           KRKDTVCI L+D+T +E KIRMNKVVR NLRVRL D++SVHQC DVKYGKR+H+LP+DDT
Sbjct: 67  KRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDT 126

Query: 606 IEGISGNLFDAYLKPYFLEAYRPVRKGDTFLARGGMRSVEFKVVETDPAEYCIVAPDTEI 785
           +EG++GNLFDAYLKPYFLEAYRPVRKGD FL RGGMRSVEFKV+ETDPAEYC+VAPDTEI
Sbjct: 127 VEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEI 186

Query: 786 FCEGEPIKREDEEKLDEVGYDDIGGV 863
           FCEGEP+KREDEE+LDEVGYDD+GGV
Sbjct: 187 FCEGEPVKREDEERLDEVGYDDVGGV 212

 Score =  197 bits (500), Expect = 7e-49
 Identities = 96/225 (42%), Positives = 153/225 (67%), Gaps = 3/225 (1%)
 Frame = +1

Query: 880  QIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVNGPEI 1059
            +++E V+ P+ HP+ F+  G+ P KG+L YGPPG GKTL+A+A+ANE  A F+ V GPE+
Sbjct: 491  ELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 550

Query: 1060 MSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQGE---VERRIVSQLLTL 1230
            ++   GESE+N+R++F +A ++AP ++F DE+DSIA +R  + G+      R+++QLLT 
Sbjct: 551  LTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSAGDAGGAADRVLNQLLTE 610

Query: 1231 MDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKLD 1410
            MDG+ ++  V +I ATNRP+ ID AL R GR D+ I I +PDE  RL + +   +   + 
Sbjct: 611  MDGMNAKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVA 670

Query: 1411 EDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQ 1545
            +DV++ A+++ T G+ GAD+  +C  A    IRE ++  D+E+E+
Sbjct: 671  KDVDVTALAKYTQGFSGADITEICQRACKYAIRENIEK-DIENER 714

 Score = 77.8 bits (190), Expect = 6e-13
 Identities = 67/277 (24%), Positives = 120/277 (43%), Gaps = 17/277 (6%)
 Frame = +1

Query: 1060 MSKLAGESESNLRKVFQEA---EKNAPSIIFIDEV----DSIAPKREKTQGEVERRIVSQ 1218
            MS     S+S  +K F  A    K +P+ + +DE     +S+      T  +++  +   
Sbjct: 1    MSNEPESSDSKTKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQ--LFRG 58

Query: 1219 LLTLMDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHT-K 1395
               L+ G K +  V +  A          + +  R +  + +G        +V+ +H   
Sbjct: 59   DTILIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLG--------DVISVHQCP 110

Query: 1396 NMKLDEDVNLEAISRDTHGYVGADLAALCTEAALQCIR--EKMDVI-------DLEDEQI 1548
            ++K  + V++  +     G  G    A      L+  R   K D+         +E + I
Sbjct: 111  DVKYGKRVHILPVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVI 170

Query: 1549 DAEVLNSMAVTQDHFKTALGMSNPSALRETVVEVPNVSWDAIGGLENVKRELQELIQYPV 1728
            + +      V  D   T +        RE    +  V +D +GG+     +++EL++ P+
Sbjct: 171  ETDPAEYCVVAPD---TEIFCEGEPVKREDEERLDEVGYDDVGGVRKQMAQIRELVELPL 227

Query: 1729 EHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANE 1839
             HP+ F+  G+ P KG+L YGPPG GKTL+A+A+ANE
Sbjct: 228  RHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANE 264

>pir||T48355 transitional endoplasmic reticulum ATPase - Arabidopsis thaliana
            gi|7378614|emb|CAB83290.1| transitional endoplasmic
            reticulum ATPase [Arabidopsis thaliana]
          Length = 843

 Score =  595 bits (1534), Expect(2) = 0.0
 Identities = 296/325 (91%), Positives = 311/325 (95%)
 Frame = +1

Query: 868  KQLAQIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVN 1047
            KQ+AQIRELVELPLRHPQLFK+IGVKPPKGILLYGPPGSGKTLIARAVANETGAFF  +N
Sbjct: 247  KQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCIN 306

Query: 1048 GPEIMSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQGEVERRIVSQLLT 1227
            GPEIMSKLAGESESNLRK F+EAEKNAPSIIFIDE+DSIAPKREKT GEVERRIVSQLLT
Sbjct: 307  GPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLT 366

Query: 1228 LMDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKL 1407
            LMDGLKSRAHVIV+ ATNRPNSIDPALRRFGRFDREIDIGVPDE GRLEV+RIHTKNMKL
Sbjct: 367  LMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKL 426

Query: 1408 DEDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQIDAEVLNSMAVTQD 1587
             EDV+LE IS+DTHGYVGADLAALCTEAALQCIREKMDVIDLED+ IDAE+LNSMAV+ +
Sbjct: 427  AEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDDSIDAEILNSMAVSNE 486

Query: 1588 HFKTALGMSNPSALRETVVEVPNVSWDAIGGLENVKRELQELIQYPVEHPEKFEKFGMSP 1767
            HF TALG SNPSALRETVVEVPNVSW+ IGGLENVKRELQE +QYPVEHPEKFEKFGMSP
Sbjct: 487  HFHTALGNSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSP 546

Query: 1768 SKGVLFYGPPGCGKTLLAKAIANEC 1842
            SKGVLFYGPPGCGKTLLAKAIANEC
Sbjct: 547  SKGVLFYGPPGCGKTLLAKAIANEC 571

 Score =  366 bits (940), Expect(2) = 0.0
 Identities = 167/200 (83%), Positives = 191/200 (95%)
 Frame = +3

Query: 264 KKDFSTAIMDRKKSPNRLIVEEAVNDDNSVVALHPKTMEKLQLFRGDTVLLKGKKRKDTV 443
           KKDFSTAI++RKKSPNRL+V+EA+NDDNSVV+LHP TMEKLQLFRGDT+L+KGKKRKDTV
Sbjct: 46  KKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKKRKDTV 105

Query: 444 CIVLSDDTVDENKIRMNKVVRKNLRVRLADIVSVHQCTDVKYGKRIHVLPIDDTIEGISG 623
           CI L+D+T +E KIRMNKVVR NLRVRL D++SVHQC DVKYGKR+H+LP+DDT+EG++G
Sbjct: 106 CIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTG 165

Query: 624 NLFDAYLKPYFLEAYRPVRKGDTFLARGGMRSVEFKVVETDPAEYCIVAPDTEIFCEGEP 803
           NLFDAYLKPYFLEAYRPVRKGD FL RGGMRSVEFKV+ETDPAEYC+VAPDTEIFCEGEP
Sbjct: 166 NLFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEP 225

Query: 804 IKREDEEKLDEVGYDDIGGV 863
           +KREDEE+LDEVGYDD+GGV
Sbjct: 226 VKREDEERLDEVGYDDVGGV 245

 Score =  197 bits (500), Expect = 7e-49
 Identities = 96/225 (42%), Positives = 153/225 (67%), Gaps = 3/225 (1%)
 Frame = +1

Query: 880  QIRELVELPLRHPQLFKTIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFVVVNGPEI 1059
            +++E V+ P+ HP+ F+  G+ P KG+L YGPPG GKTL+A+A+ANE  A F+ V GPE+
Sbjct: 524  ELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPEL 583

Query: 1060 MSKLAGESESNLRKVFQEAEKNAPSIIFIDEVDSIAPKREKTQGE---VERRIVSQLLTL 1230
            ++   GESE+N+R++F +A ++AP ++F DE+DSIA +R  + G+      R+++QLLT 
Sbjct: 584  LTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSAGDAGGAADRVLNQLLTE 643

Query: 1231 MDGLKSRAHVIVIAATNRPNSIDPALRRFGRFDREIDIGVPDETGRLEVMRIHTKNMKLD 1410
            MDG+ ++  V +I ATNRP+ ID AL R GR D+ I I +PDE  RL + +   +   + 
Sbjct: 644  MDGMNAKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVA 703

Query: 1411 EDVNLEAISRDTHGYVGADLAALCTEAALQCIREKMDVIDLEDEQ 1545
            +DV++ A+++ T G+ GAD+  +C  A    IRE ++  D+E+E+
Sbjct: 704  KDVDVTALAKYTQGFSGADITEICQRACKYAIRENIEK-DIENER 747

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 31/70 (44%), Positives = 48/70 (68%)
 Frame = +1

Query: 1630 RETVVEVPNVSWDAIGGLENVKRELQELIQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGK 1809
            RE    +  V +D +GG+     +++EL++ P+ HP+ F+  G+ P KG+L YGPPG GK
Sbjct: 228  REDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGK 287

Query: 1810 TLLAKAIANE 1839
            TL+A+A+ANE
Sbjct: 288  TLIARAVANE 297



EST assemble image


clone accession position
1 MXL074b11_r BP097344 1 481
2 MXL058e10_r BP096426 21 488
3 LCL013b11_r AV626662 89 445
4 LCL070a11_r AV629961 96 409
5 LCL096h02_r AV631605 96 655
6 LCL091d11_r AV631286 96 312
7 MXL070g07_r BP097141 96 462
8 LCL042a02_r AV628445 96 541
9 LCL022f12_r AV627207 96 547
10 MXL076g05_r BP097498 96 602
11 LCL067a09_r AV629828 97 555
12 LCL066e06_r AV629809 97 534
13 MXL039h07_r BP095321 98 496
14 MXL085e03_r BP098023 98 432
15 MXL085c08_r BP098011 98 608
16 MXL053d02_r BP096136 98 595
17 MXL096h10_r BP098650 98 594
18 MXL012f01_r BP093720 99 500
19 MXL086g07_r BP098087 99 460
20 MXL099h11_r BP098834 99 478
21 MXL033c01_r BP094953 99 496
22 MXL089d10_r BP098212 99 540
23 MXL092h08_r BP098408 99 546
24 LCL004b11_r AV626203 101 654
25 MXL100b01_r BP098845 101 479
26 MXL095h03_r BP098583 106 547
27 LCL075c01_r AV630197 106 489
28 LCL088e04_r AV631082 106 577
29 MXL052g05_r BP096105 106 507
30 LCL008e08_r AV626403 111 615
31 LCL083e04_r AV630736 111 541
32 LCL001d03_r AV626033 111 607
33 HCL066a09_r AV643231 111 651
34 LCL042h06_r AV628503 112 651
35 MXL081e03_r BP097797 112 564
36 MXL097d03_r BP098685 113 473
37 MXL004c10_r BP093158 113 547
38 MXL073a06_r BP097284 113 563
39 MXL017b11_r BP094030 117 444
40 LCL029f07_r AV627624 117 653
41 MXL035h06_r BP095104 117 467
42 LCL062f09_r AV629651 117 534
43 LCL076d12_r AV630272 117 539
44 MXL030h12_r BP094846 117 601
45 HCL052h12_r AV642502 120 627
46 MXL001d05_r BP092956 121 315
47 LCL074h09_r AV630180 121 557
48 MXL083e04_r BP097916 122 523
49 MXL006d11_r BP093302 143 322
50 MXL077g01_r BP097557 147 525
51 MXL027h09_r BP094710 148 535
52 LCL092c09_r AV631340 150 544
53 MXL004a03_r BP093141 152 481
54 MXL098e06_r BP098752 159 524
55 MXL035d08_r BP095077 162 447
56 MXL059c03_r BP096468 164 501
57 MXL070e06_r BP097125 164 525
58 MXL067a12_r BP096919 164 618
59 MXL072c11_r BP097241 164 534
60 MXL059h07_r BP096512 185 668
61 MXL019a04_r BP094167 211 364
62 MXL021d11_r BP094336 213 462
63 LCL004e12_r AV626222 278 507
64 MXL010b07_r BP093562 300 567
65 MXL001h06_r BP092990 310 760
66 LCL025c03_r AV627338 313 861
67 LCL046a08_r AV628711 353 879
68 MXL025c09_r BP094586 361 759
69 MXL038a10_r BP095208 404 688
70 LCL098e04_r AV631707 542 959
71 HCL089c08_r AV644482 618 1183
72 LCL036b12_r AV628067 624 1114
73 MXL057e07_r BP096362 644 1000
74 LCL087g01_r AV631021 737 1163
75 LCL054d08_r AV629208 752 1230
76 LCL054a08_r AV629195 752 1165
77 CL09g12_r AV393743 860 1330
78 LCL066b09_r AV629785 1140 1545
79 LCL063e12_r AV629681 1401 1857




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research