KCC000197A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000197A_C02 KCC000197A_c02
GCAACATACAGTTCTAGCCAAGTAGCAACGCACAACTTCAAGCCTTGATCAATCAGTATG
GACCTCGCCACCGCGCTTGGACTGGGCATAGCCCCCCCGCCGCCCGCGGACGACTCCTCC
CACCACAGCACCACGGAAGCATGCACTCTGCCGGCGTATCTGCGCGCGCCGGAGGTGACG
GCCCAGGTTATGGCCGAGTACATCTGGCTGATGGGTGGGACCGGCCAGCTGCGCAGCAAG
ACTAAGGTGCTGGACGCCAAGCCGTCTTGTGCCGAGGAGGCCCCTATCATGATTGTGGAG
AGCAACCCAGACGGCCAGCTCGCCGAGCCGAACCATGAGCTTTTCCTCAAGCCCCGCAAG
ATCTTCCGGGACCCCTTCCGCGGCGGCGACCACATTCTGGTCCTCTGCGACACATTCATC
GTCGCCCAGGTTGTCGCGGAGGCTGGTGCGGCTCCCTCGACCGTGCTGCAGCCCAGCGAG
ACCAACAGCCGCGTTGCGTGCGAGAACGTCCTGCGCGTTGCCGAGCAGCAGGAGCCCGTG
TTTGCGGTGGAGCAGGAGTACGCCATCATCCACCCGGCGTACCCCACGAAGGTTCCGCTG
GGACCTCGGCGCCCTTCGACCTCGCGCGCCAGCAGCTGCCACAGCGGCTCGCGCCGCAGC
AGCTACGTGTCCAGTGGCTCAGCGCGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000197A_C02 KCC000197A_c02
         (688 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q42688|GLN1_CHLRE Glutamine synthetase, cytosolic isozyme (Gl...   104  1e-21
gb|AAP06276.1| similar to GenBank Accession Number AY044241 glut...    94  2e-18
sp|Q04831|GLNA_PANAR GLUTAMINE SYNTHETASE (GLUTAMATE--AMMONIA LI...    89  6e-17
gb|AAH31964.1| GLUL protein [Homo sapiens]                             88  1e-16
emb|CAD97626.1| hypothetical protein [Homo sapiens]                    88  1e-16

>sp|Q42688|GLN1_CHLRE Glutamine synthetase, cytosolic isozyme (Glutamate--ammonia ligase)
           (GS1) gi|7437922|pir||T08088 glutamate-ammonia ligase
           (EC 6.3.1.2), cytosolic - Chlamydomonas reinhardtii
           gi|1353876|gb|AAB01817.1| glutamine synthetase
           [Chlamydomonas reinhardtii]
          Length = 382

 Score =  104 bits (259), Expect = 1e-21
 Identities = 56/141 (39%), Positives = 86/141 (60%), Gaps = 1/141 (0%)
 Frame = +1

Query: 184 QVMAEYIWLMGGTGQLRSKTKVLDAKPSCAEEAPIMIVESNPDGQLAEPNHELFLKPRKI 363
           ++ AEY+W+ G    +RSK++ L   P+  E+ P    + +  GQ    + E++L PR I
Sbjct: 37  KICAEYVWIGGSMHDVRSKSRTLSTIPTKPEDLPHWNYDGSSTGQAPGHDSEVYLIPRSI 96

Query: 364 FRDPFRGGDHILVLCDTFIVAQVVAEAG-AAPSTVLQPSETNSRVACENVLRVAEQQEPV 540
           F+DPFRGGD+ILV+CD +   +V  +   AAP    +P  TN+R AC  V+  A+++EP 
Sbjct: 97  FKDPFRGGDNILVMCDCYEPPKVNPDGTLAAP----KPIPTNTRFACAEVMEKAKKEEPW 152

Query: 541 FAVEQEYAIIHPAYPTKVPLG 603
           F +EQEY +++    TK PLG
Sbjct: 153 FGIEQEYTLLNAI--TKWPLG 171

>gb|AAP06276.1| similar to GenBank Accession Number AY044241 glutamine synthetase
           [Schistosoma japonicum]
          Length = 364

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 57/167 (34%), Positives = 81/167 (48%), Gaps = 1/167 (0%)
 Frame = +1

Query: 100 PPADDSSHHSTTEACTLPAYLRAPEVTAQVMAEYIWLMGGTGQLRSKTKVLDAKPSCAEE 279
           P    S H S T    L  Y   P+   +V   Y+W+ G    LR KT  L  +P   E+
Sbjct: 2   PLTSRSPHDSKT---LLAKYYDLPQPDDKVQVMYVWIDGSGENLRCKTMTLPDEPQAPED 58

Query: 280 APIMIVESNPDGQLAEPNHELFLKPRKIFRDPFRGGDHILVLCDTFIVAQVVAEAGAAPS 459
            P+   + +  GQ    N +++LKP  +FRDPFRGG + LVLC+TF   +          
Sbjct: 59  CPMWNFDGSSTGQAEGSNSDVYLKPCAMFRDPFRGGKNKLVLCETFNYDK---------- 108

Query: 460 TVLQPSETNSRVACENVLRVAEQQEPVFAVEQEYAIIH-PAYPTKVP 597
              +P  +N R  C  V+  A+  EP F +EQEYA++    YP + P
Sbjct: 109 ---KPHVSNHRYLCNLVMEKAKIHEPWFGIEQEYALLDIDGYPLQWP 152

>sp|Q04831|GLNA_PANAR GLUTAMINE SYNTHETASE (GLUTAMATE--AMMONIA LIGASE)
           gi|543538|pir||JN0716 glutamate-ammonia ligase (EC
           6.3.1.2) - spiny lobster gi|160786|gb|AAA02583.1|
           glutamine synthetase
          Length = 361

 Score = 89.0 bits (219), Expect = 6e-17
 Identities = 55/161 (34%), Positives = 80/161 (49%), Gaps = 5/161 (3%)
 Frame = +1

Query: 148 LPAYLRAPEVTAQVMAEYIWLMGGTGQLRSKTKVLDAKPSCAEEAPIMIVESNPDGQLAE 327
           L  YLR      +  A YIW+ G    LRSKT+ L+  P    E PI   + +  GQ   
Sbjct: 10  LDRYLRLDIPDQKCQAMYIWVDGTGENLRSKTRTLNFTPKSPSELPIWNFDGSSTGQAER 69

Query: 328 PNHELFLKPRKIFRDPFRGGDHILVLCDTFIVAQVVAEAGAAPSTVLQPSETNSRVACEN 507
            N +++L P  ++RDPFR G++ LVLC+T+   +             +P++TN R  C  
Sbjct: 70  SNSDVYLYPVAVYRDPFRLGNNKLVLCETYKYNK-------------KPADTNQRWKCME 116

Query: 508 VLRVAEQQEPVFAVEQEYAII----HP-AYPTKVPLGPRRP 615
           V+  A  Q P F +EQEY ++    HP  +P     GP+ P
Sbjct: 117 VMTRAADQHPWFGMEQEYTLLDIDKHPLGWPKNGYPGPQGP 157

>gb|AAH31964.1| GLUL protein [Homo sapiens]
          Length = 373

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 53/158 (33%), Positives = 81/158 (50%), Gaps = 5/158 (3%)
 Frame = +1

Query: 157 YLRAPEVTAQVMAEYIWLMGGTGQLRSKTKVLDAKPSCAEEAPIMIVESNPDGQLAEPNH 336
           Y+  P+   +V A YIW+ G    LR KT+ LD++P C EE P    + +   Q    N 
Sbjct: 17  YMSLPQ-GEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNS 75

Query: 337 ELFLKPRKIFRDPFRGGDHILVLCDTFIVAQVVAEAGAAPSTVLQPSETNSRVACENVLR 516
           +++L P  +FRDPFR   + LVLC+ F   +             +P+ETN R  C+ ++ 
Sbjct: 76  DMYLVPAAMFRDPFRKDPNKLVLCEVFKYNR-------------RPAETNLRHTCKRIMD 122

Query: 517 VAEQQEPVFAVEQEYAII----HP-AYPTKVPLGPRRP 615
           +   Q P F +EQEY ++    HP  +P+    GP+ P
Sbjct: 123 MVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFTGPQGP 160

>emb|CAD97626.1| hypothetical protein [Homo sapiens]
          Length = 373

 Score = 87.8 bits (216), Expect = 1e-16
 Identities = 53/158 (33%), Positives = 81/158 (50%), Gaps = 5/158 (3%)
 Frame = +1

Query: 157 YLRAPEVTAQVMAEYIWLMGGTGQLRSKTKVLDAKPSCAEEAPIMIVESNPDGQLAEPNH 336
           Y+  P+   +V A YIW+ G    LR KT+ LD++P C EE P    + +   Q    N 
Sbjct: 17  YMSLPQ-GEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNS 75

Query: 337 ELFLKPRKIFRDPFRGGDHILVLCDTFIVAQVVAEAGAAPSTVLQPSETNSRVACENVLR 516
           +++L P  +FRDPFR   + LVLC+ F   +             +P+ETN R  C+ ++ 
Sbjct: 76  DMYLVPAAMFRDPFRKDPNKLVLCEVFKYNR-------------RPAETNLRHTCKRIMD 122

Query: 517 VAEQQEPVFAVEQEYAII----HP-AYPTKVPLGPRRP 615
           +   Q P F +EQEY ++    HP  +P+    GP+ P
Sbjct: 123 MVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGLPGPQGP 160



EST assemble image


clone accession position
1 HCL085f12_r AV644294 1 347
2 CL17a04_r AV394120 54 685
3 LCL092b03_r AV631331 105 258
4 LCL029c09_r AV627601 105 608
5 LCL046g08_r AV628769 108 426
6 CL09g11_r AV393706 112 626
7 LCL030g06_r AV627701 112 457
8 CL63c11_r AV396538 114 625
9 HCL056h10_r AV642734 114 620
10 CL30g10_r AV394778 115 636
11 LCL083d12_r AV630733 115 540
12 LCL025a06_r AV627325 115 478
13 LCL066c06_r AV629791 115 480
14 MXL048c05_r BP095846 115 565
15 LCL034f01_r AV627965 115 409
16 LCL046c11_r AV628734 115 424
17 HCL027d07_r AV641080 115 618
18 HCL065h08_r AV643222 116 620
19 HCL053b10_r AV642518 120 566
20 HCL051c03_r AV642404 122 620
21 HCL006d11_r AV639869 124 540
22 LCL076c12_r AV630264 125 540
23 HCL043e10_r AV641993 130 540
24 CL39c06_r AV395188 138 656
25 HCL092f02_r AV644704 139 536
26 CL48b02_r AV395824 144 573
27 LCL033d04_r AV627886 144 606
28 LCL061a01_r AV629559 146 534
29 HCL021e04_r AV640733 150 602
30 CL36b02_r AV395113 285 804
31 LCL084h02_r AV630827 302 783




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research