KCC000196A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000196A_C02 KCC000196A_c02
TTACGTAGCCGAACCCTATCAAAATGGCCATGCTGCTGAAGTCCCGTGTGTCCGCCGGTG
TGTCGCGCCCCTCGCGCGCCACCGTGCGCGTGAGCGCGTCGACCCGCCCCTATGTGGTAC
CCCGGCGCCACCGCCCCTGGCTCACCTGGACTGGCTCCCATGCTGGGTGACTACGTGCTT
CGACCCCCTCCGCCTGGTGCTGTGAACAAGGACAACCTGAAGTGGTTCCGTGAGTGCTGA
GCTGACCAACGGCCGCTGGGCCATGGCTGCCCGTTGTCGGCATCCTGTTCACCGACGCCG
TGTGGGCCTGCCCAAGTTCTGGACCGCTGGTGCTGAGAAGTACGCCCTGGACAACCAGAC
CCTGGCTCTGATTGAGGTCGCCGTGTTCTGCCGTGCTGGAGGGCAAGCTGCTACGAGATC
TACAAGAAGACCGGCGAGACCGGCTTCCTGTCGTTCGCCCCCTTCGACCCCATGGGCATG
AAGAGCGAGGAGATGAAGCTGAAGGAGCTGAAGAACGGCCGCCTGGCCATGCTGGCGTTC
CTGGGCTTCTGCTCTCAGGCCGCTGTGTACGGCAAGGGCCCCATTGAGACCCTGCAGCTG
CACCTGGCTGACCCCGGCCACAACAACATCTACACCTCGTCGGTGGGCCCTGAGACCGCC
GTGACCGTGGCCGTGCTGTGCGTGCTGCCCATGATCATTGAGGCCACCAAGACCCTGAAC
CCCGGCAAGGAGTCCGTGCCCTACTTCCCCTGGAACGAGCCCTGGAACAAGGTGTAAGCT
GCCCCAATGTGGGCGCAGCGGCACCTGGGGAGCGCTTCTTTTGGGCCGTGACCTGGCCGC
GACAGCACCAATCACCTGCCTGACAGCGTGATGCTGGTGTTTTTTGGGAGCCACGGGCGC
AGCTCGCGACGTCGTGCGGCTGCCGGCGCCGCTTACCGCACCTGATGTTTGGGGCGGTGG
CGGCGTGTCTGGTGGAGGCAAGCCTTGGCGCGGAGCGTCCATGTGTGGCGGCGGCGGGTG
GCGGCTCAGCGAATCCCCTGCACGGCAGCAACCAGGACAAGCATTCTGGCGCAGCAGCTG
TGTGTGTATTATTGGAGCTCTGGACTTGAGCAGGGAGCTGTTTAGGCGGAGGGGACCTGG
TTGCAGGTCACCGTGGTTGCGGCGGCCTGTAGCCTGTGTAAAGGGTCTCTGTCCGCCTGT
CCGGTGTCGGCTGGCGGTTGACGGAATGAGGCGGTTGTGCTGGAGGTGACGACAGCATGA
CGCGACTCTGTCGGCAGGCGCGCCGAGTTGGTGTGAGCTGGACGTGTTTTTTGCATGACT
GGCGCTCGGGTGCGTGGAACGTTGGGACTAGATCTCAGGAGGTCGTGTTGCTCCGTGTCA
GGTTTGAGCGCAGCGTGCGGCTCGGACCGGAGGACTTCACGTCTATGGAGAGCATGCGTA
GTTCAGCGGCCCCTGGCACAGGCATCCACCATGTGTGTGCTGTGAACTGATTTGCGCATT
CCCATCAATTTTGGCTCAGAGAAGACAATCAACATATAAAATTGCACGGGGAAAGCTCGT
GTAATCCACATTAAGGTCCC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000196A_C02 KCC000196A_c02
         (1580 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAL87738.1|AF244524_1 chlorophyll a/b-binding protein [Chlamy...    86  5e-20
gb|AAD55569.1|AF110787_1 light harvesting complex a protein [Vol...    79  1e-16
pir||S60608 chlorophyll a/b-binding protein type II precursor, p...    63  5e-16
dbj|BAC83072.1| putative photosystem I antenna protein [Oryza sa...    65  6e-16
pir||S52341 LHCI-680, photosystem I antenna protein - barley gi|...    65  2e-15

>gb|AAL87738.1|AF244524_1 chlorophyll a/b-binding protein [Chlamydomonas reinhardtii]
          Length = 222

 Score = 85.9 bits (211), Expect(2) = 5e-20
 Identities = 45/83 (54%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +1

Query: 412 YEIYKKTGETGFLSFAPFDPMGMKSEEMKLKELKNGRLAMLAFLGFCSQAAVYGKGPIET 591
           Y+ +K+TG +GF++  PFDP GM S  M  KE+KNGRLAM+AF+GFC QA      PIE 
Sbjct: 127 YQGFKQTGTSGFINSFPFDPAGMNSPSMATKEVKNGRLAMVAFIGFCVQALATRTQPIEG 186

Query: 592 LQLHLADP-GHNNIYTSSVGPET 657
           L  HLADP G N  Y  +  PET
Sbjct: 187 LTAHLADPFGKNITYYLTHLPET 209

 Score = 35.8 bits (81), Expect(2) = 5e-20
 Identities = 21/50 (42%), Positives = 25/50 (50%)
 Frame = +2

Query: 236 AELTNGRWAMAARCRHPVHRRRVGLPKFWTAGAEKYALDNQTLALIEVAV 385
           AE TNGRWAM A             P +W AGA++Y +  Q L  IE  V
Sbjct: 69  AEKTNGRWAMMAVAGILGQELLGVTPAWWEAGAKEYDIPAQALTPIEFIV 118

>gb|AAD55569.1|AF110787_1 light harvesting complex a protein [Volvox carteri f. nagariensis]
          Length = 214

 Score = 78.6 bits (192), Expect(2) = 1e-16
 Identities = 39/73 (53%), Positives = 49/73 (66%)
 Frame = +1

Query: 412 YEIYKKTGETGFLSFAPFDPMGMKSEEMKLKELKNGRLAMLAFLGFCSQAAVYGKGPIET 591
           Y+ +K TG +GF++  PFDP G+ S  M  KE+KNGRLAM+AF+GF  QA V    PIE 
Sbjct: 127 YQGFKTTGTSGFINSFPFDPAGLNSASMATKEVKNGRLAMVAFVGFAVQALVTRTQPIEG 186

Query: 592 LQLHLADPGHNNI 630
           L  HL+DP   NI
Sbjct: 187 LTKHLSDPFGKNI 199

 Score = 32.0 bits (71), Expect(2) = 1e-16
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +2

Query: 236 AELTNGRWAMAARCRHPVHRRRVGL-PKFWTAGAEKYALDNQTLALIEVAV 385
           AE TNGRWAM A     + +  +G+ P ++ AGA++Y + +  L  IE  V
Sbjct: 69  AEKTNGRWAMMA-VTGILGQELLGVTPSWYEAGAKEYDIPSTPLTAIEFIV 118

>pir||S60608 chlorophyll a/b-binding protein type II precursor, photosystem I -
           garden pea gi|602359|emb|CAA57492.1| Type II chlorophyll
           a/b binding protein from photosystem I [Pisum sativum]
          Length = 269

 Score = 63.2 bits (152), Expect(3) = 5e-16
 Identities = 36/79 (45%), Positives = 47/79 (58%), Gaps = 7/79 (8%)
 Frame = +1

Query: 424 KKTG-ETGFLSFAPFDPMG------MKSEEMKLKELKNGRLAMLAFLGFCSQAAVYGKGP 582
           K TG + G+     FDP+G       K +E++ KE+KNGRLAMLA +G   Q    G GP
Sbjct: 187 KLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGP 246

Query: 583 IETLQLHLADPGHNNIYTS 639
           I+ L  HLADPGH  I+ +
Sbjct: 247 IDNLFAHLADPGHATIFAA 265

 Score = 37.0 bits (84), Expect(3) = 5e-16
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)
 Frame = +2

Query: 227 SVSAELTNGRWAM--AARCRHPVHRRRVGL---PKFWTAGAEKYALDNQTLALIEVAVFC 391
           +V AEL + RWAM  AA    P    ++G+   P ++TAG ++Y  D  TL ++E+    
Sbjct: 102 NVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIG 161

Query: 392 RAGGQ 406
            A G+
Sbjct: 162 WAEGR 166

 Score = 27.7 bits (60), Expect(3) = 5e-16
 Identities = 17/48 (35%), Positives = 26/48 (53%), Gaps = 1/48 (2%)
 Frame = +1

Query: 85  CA*ARRPAPMWYPGATAPGSPGLAPML-GDYVLRPPPPGAVNKDNLKW 225
           C  A    P+W+PG+T P  P L   L GD+   P   G+ + ++L+W
Sbjct: 57  CTVAEPDRPLWFPGSTPP--PWLDGSLPGDFGFDPLGLGS-DPESLRW 101

>dbj|BAC83072.1| putative photosystem I antenna protein [Oryza sativa (japonica
           cultivar-group)]
          Length = 263

 Score = 64.7 bits (156), Expect(3) = 6e-16
 Identities = 37/77 (48%), Positives = 47/77 (60%), Gaps = 7/77 (9%)
 Frame = +1

Query: 424 KKTG-ETGFLSFAPFDPMGM------KSEEMKLKELKNGRLAMLAFLGFCSQAAVYGKGP 582
           K TG + G+     FDP+G       K +E++ KE+KNGRLAMLA +G   QA   G GP
Sbjct: 181 KLTGTDVGYPGGLWFDPLGWGTGSPEKIKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGP 240

Query: 583 IETLQLHLADPGHNNIY 633
           I+ L  HLADPGH  I+
Sbjct: 241 IDNLFAHLADPGHATIF 257

 Score = 37.4 bits (85), Expect(3) = 6e-16
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 5/65 (7%)
 Frame = +2

Query: 227 SVSAELTNGRWAM--AARCRHPVHRRRVGL---PKFWTAGAEKYALDNQTLALIEVAVFC 391
           +V AEL + RWAM  AA    P    ++G+   P ++TAG ++Y  D  TL +IE+ +  
Sbjct: 96  NVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQQYFTDTTTLFIIELILIG 155

Query: 392 RAGGQ 406
            A G+
Sbjct: 156 WAEGR 160

 Score = 25.4 bits (54), Expect(3) = 6e-16
 Identities = 15/40 (37%), Positives = 24/40 (59%), Gaps = 1/40 (2%)
 Frame = +1

Query: 109 PMWYPGATAPGSPGLAPML-GDYVLRPPPPGAVNKDNLKW 225
           P+W+PG+T P  P L   L GD+   P   G+ + ++L+W
Sbjct: 59  PIWFPGSTPP--PWLDGSLPGDFGFDPLGLGS-DPESLRW 95

>pir||S52341 LHCI-680, photosystem I antenna protein - barley
           gi|666054|emb|CAA59049.1| LHCI-680, photosystem I
           antenna protein [Hordeum vulgare subsp. vulgare]
          Length = 255

 Score = 64.7 bits (156), Expect(3) = 2e-15
 Identities = 37/77 (48%), Positives = 47/77 (60%), Gaps = 7/77 (9%)
 Frame = +1

Query: 424 KKTG-ETGFLSFAPFDPMGM------KSEEMKLKELKNGRLAMLAFLGFCSQAAVYGKGP 582
           K TG + G+     FDP+G       K +E++ KE+KNGRLAMLA +G   QA   G GP
Sbjct: 173 KLTGTDVGYPGGLWFDPLGYGTGSPEKLKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGP 232

Query: 583 IETLQLHLADPGHNNIY 633
           I+ L  HLADPGH  I+
Sbjct: 233 IDNLFAHLADPGHATIF 249

 Score = 36.2 bits (82), Expect(3) = 2e-15
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 5/65 (7%)
 Frame = +2

Query: 227 SVSAELTNGRWAM--AARCRHPVHRRRVGL---PKFWTAGAEKYALDNQTLALIEVAVFC 391
           +V AEL + RWAM  AA    P    ++G+   P ++TAG ++Y  D  TL ++E+ +  
Sbjct: 88  NVQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELILIG 147

Query: 392 RAGGQ 406
            A G+
Sbjct: 148 WAEGR 152

 Score = 25.0 bits (53), Expect(3) = 2e-15
 Identities = 15/40 (37%), Positives = 24/40 (59%), Gaps = 1/40 (2%)
 Frame = +1

Query: 109 PMWYPGATAPGSPGLAPML-GDYVLRPPPPGAVNKDNLKW 225
           P+W+PG+T P  P L   L GD+   P   G+ + ++L+W
Sbjct: 51  PIWFPGSTPP--PWLDGSLPGDFGFDPWGLGS-DPESLRW 87



EST assemble image


clone accession position
1 MX231f11_r BP090960 1 547
2 MX235e04_r BP091215 4 566
3 LC042g03_r AV621926 6 675
4 MX228a02_r BP090713 11 532
5 HC060c02_r AV636493 27 626
6 MX219h09_r BP090169 41 512
7 CL09g06_r AV393751 46 676
8 CM056c06_r AV390275 90 723
9 LC002b01_r AV618975 100 641
10 CM020a05_r AV397454 100 592
11 CM004h12_r AV386690 101 644
12 MX231f02_r BP090954 101 457
13 LC033e03_r AV621257 104 683
14 MX254d09_r BP092451 104 662
15 CM054b05_r AV389987 104 568
16 CM086d01_r AV392519 104 643
17 HC048c12_r AV635596 104 567
18 HC082a04_r AV638104 104 666
19 HC031g10_r AV634314 104 598
20 CM027g07_r AV387637 105 737
21 CM017b03_r AV388195 105 744
22 CM003a02_r AV386542 105 726
23 LC071f09_r AV624007 105 624
24 CM032d11_r AV388493 105 625
25 CM049b07_r AV389602 106 467
26 CM054e07_r AV390026 106 452
27 LCL098d04_r AV631697 107 571
28 CM043f03_r AV389491 108 458
29 MX016b12_r BP086761 108 583
30 LC072c07_r AV624052 108 601
31 LCL035e05_r AV628021 108 648
32 LC052d07_r AV622647 108 662
33 MX215b02_r BP089862 108 474
34 LC084a01_r AV624877 108 703
35 MX017c03_r BP086807 108 578
36 HC002a08_r AV631946 108 568
37 LC045d09_r AV622061 108 674
38 CM049h10_r AV389665 108 624
39 LC028d12_r AV620908 108 717
40 MXL010f05_r BP093593 108 460
41 HC003d09_r AV632062 108 629
42 HC039h10_r AV634942 108 641
43 LCL098h10_r AV631734 108 586
44 LC011g02_r AV619684 108 716
45 MX259f04_r BP092821 109 671
46 CM027d12_r AV387642 109 784
47 LC015b09_r AV619929 109 670
48 LC024d08_r AV620615 109 698
49 LC040g12_r AV621779 109 717
50 CM005e03_r AV386863 109 733
51 MX257f03_r BP092676 109 655
52 MX208h07_r BP089514 109 508
53 MX259e11_r BP092817 110 644
54 LC060g07_r AV623232 110 644
55 LC072b06_r AV624041 110 648
56 MX245a02_r BP091834 110 661
57 LC065h07_r AV623583 110 660
58 LC096f11_r AV625703 111 574
59 CM069g08_r AV391197 111 800
60 HCL030e06_r AV641251 112 708
61 MX218a09_r BP090052 112 483
62 MX020g10_r BP086935 112 587
63 HC089h03_r AV638716 112 588
64 HC023b10_r AV633629 112 667
65 MX051a09_r BP088078 112 601
66 HCL042f02_r AV641930 112 571
67 MX208b11_r BP089483 113 536
68 HC021b10_r AV633469 113 699
69 HC054h01_r AV636072 113 629
70 MX208d06_r BP089494 113 531
71 MX004e04_r BP086224 113 621
72 CM020d04_r AV397502 113 771
73 MX065f09_r BP088643 113 528
74 MX048f02_r BP087984 113 488
75 CM043f12_r AV389501 113 516
76 HC087h06_r AV638557 113 593
77 HC011c05_r AV632681 113 598
78 HC063e06_r AV636734 113 606
79 MXL067f01_r BP096953 113 567
80 MX229d08_r BP090808 113 616
81 HC058b10_r AV636338 113 620
82 MX034a07_r BP087414 113 559
83 MX231f12_r BP090961 113 633
84 HC044d04_r AV635285 113 554
85 HC053f09_r AV635985 113 657
86 HC045a07_r AV635332 113 660
87 HC036b04_r AV634657 113 668
88 HC076h06_r AV637740 113 677
89 MX238h04_r BP091445 114 467
90 MX257c08_r BP092652 114 657
91 HC015h12_r AV633039 114 468
92 HC024g11_r AV633752 114 672
93 LC012f10_r AV619755 114 717
94 HC024g12_r AV633753 114 698
95 CM038f09_r AV389036 114 639
96 CM031d03_r AV388298 114 285
97 MX259c01_r BP092790 114 582
98 CM065h08_r AV391146 114 773
99 LC019a05_r AV620205 114 712
100 CM055c11_r AV390201 114 778
101 HC014e09_r AV632933 116 665
102 MX251f03_r BP092249 116 644
103 MX260g12_r BP092918 117 578
104 LC068b06_r AV623750 117 701
105 CM048c06_r AV389093 119 628
106 MX249f09_r BP092092 121 616
107 HC092g12_r AV638938 122 570
108 LCL076h04_r AV630299 124 613
109 MXL047g01_r BP095809 124 502
110 CM050f08_r AV389753 124 453
111 CM049f02_r AV389623 124 583
112 CM086c10_r AV392540 124 751
113 LCL020b09_r AV627037 125 574
114 HC020e12_r AV633418 125 670
115 MX208f03_r BP089503 125 529
116 HC082f10_r AV638159 125 588
117 LC064f07_r AV623494 127 676
118 LC068g03_r AV623796 127 671
119 MX043e07_r BP087783 128 627
120 MX251g04_r BP092259 133 580
121 MX033h05_r BP087407 139 662
122 HC014e11_r AV632935 141 664
123 MX233e05_r BP091082 142 467
124 LC091b01_r AV625336 143 590
125 HC068e12_r AV637092 148 648
126 HC013e07_r AV637092 165 568
127 LC091c01_r AV625344 171 652
128 CM001b08_r AV386464 181 797
129 LC091e02_r AV625360 184 654
130 LC091g03_r AV625378 188 592
131 CM081b01_r AV391905 200 762
132 CM019c02_r AV387313 238 811
133 CM019c05_r AV387302 238 802
134 MX026h04_r BP087155 250 778
135 CM086f12_r AV392499 269 633
136 CM078c02_r AV391801 285 909
137 LC026d06_r AV620753 371 930
138 MX235f06_r BP091224 377 813
139 LC032c07_r AV621174 382 912
140 HC089e09_r AV638695 387 722
141 HC006d06_r AV632294 434 891
142 MX223b06_r BP090379 496 791
143 MX049b07_r BP088001 511 939
144 MX029a06_r BP087251 512 893
145 HC098e11_r AV639376 527 930
146 HC036b01_r AV634654 544 1047
147 LC062a02_r AV623312 573 1078
148 HC044f01_r AV635300 582 1114
149 CM037b05_r AV388857 586 1117
150 CM054g06_r AV389976 591 878
151 LC061c07_r AV623266 594 1070
152 LC049f01_r AV622428 594 1054
153 LC100e08_r AV625972 597 876
154 LC069f06_r AV623859 600 1108
155 MXL033g03_r BP094977 609 977
156 HC013f02_r AV632859 645 1114
157 LC043f10_r AV621996 646 1171
158 CM025d11_r AV388133 649 1234
159 LC036h03_r AV621492 657 1202
160 HC006e07_r AV632305 670 1168
161 CM038g11_r AV389018 671 1011
162 HC074e07_r AV637551 673 1181
163 CL80d05_r AV397301 708 1224
164 CM045d09_r AV389693 746 1271
165 CM046c01_r AV388013 746 1307
166 MXL041b08_r BP095394 829 1227
167 CM021a01_r AV387967 859 1443
168 MX104f03_r BP089084 867 1248
169 MX062h03_r BP088541 896 1232
170 CM090f01_r AV392321 985 1334
171 HC055c12_r AV636114 1048 1543
172 CM069c08_r AV391195 1117 1748
173 MXL016a05_r BP093941 1129 1610
174 CL10f06_r AV393665 1156 1606
175 CM052d03_r AV390540 1171 1614
176 LC024f04_r AV620630 1241 1797
177 HC006h10_r AV632339 1292 1780
178 LC054a12_r AV622755 1335 1835
179 HC093e06_r AV638990 1410 1767
180 CM038f05_r AV389030 1544 1748




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research