KCC000195A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000195A_C01 KCC000195A_c01
gtcggcggcggacgccagtgatcacgccgttagcagtggaggcagttgacgtgtacaagg
aggctacggctgctgcggccATCTCGTTGCAAACCTCGGGAGACAAGCTGCCTTCCCAGG
TGGGAGCAGAGGGCAGCCGCAGCCTACAAGACGGCGGCGGGAGCACGTGGCCCTTTGCAT
GCTCGCCTGCGGCCTTGTACAGCAGTCATAACAGTGCCGCGACAGCTCCAGGTGATGCGG
GAGACCTGTACCGCTTCTCGTCTATCGGCCAAGGCCCAACTGGCGCCGGTGCTCAGAGCC
ACCGCGGTCCTCGCCGGCTGCTGTCTGCCGCCGACCTCAGCAGCGGTGTCGGTGTGGTGC
AGCGCAGGACCCGCAACTCAGAAGCCACCGTATTAGCCGAGCCGGCGCTGCCCTGCAGCG
GTAGCGGCGATGGCGAACCTGCAGTGCAGCAGCATCCAGCAAGCCATCCGCGGCGGCAGC
GTCCCACGCTGCACGCATTTGTGTCTGTCGTACAACCGAGTGCGGCGGATGTGGATTTCG
ATTCGGACGAGCCCCCTGAAGTCACTGGCGTCTGCTGTGGCAACGACCATGCC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000195A_C01 KCC000195A_c01
         (593 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_800867.1| hypothetical protein VPA1357 [Vibrio parahaemol...    42  0.006
sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 (cRax2) gi|6002...    41  0.014
gb|AAN32718.1|AF420600_1 homeobox transcription factor RAX1 [Gal...    41  0.014
ref|NP_499059.2| tenascin XB precursor (64.1 kD) (3K438) [Caenor...    39  0.071
ref|NP_499058.2| tenascin XB precursor (3K438) [Caenorhabditis e...    39  0.071

>ref|NP_800867.1| hypothetical protein VPA1357 [Vibrio parahaemolyticus RIMD 2210633]
           gi|28809725|dbj|BAC62700.1| hypothetical protein [Vibrio
           parahaemolyticus]
          Length = 1622

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 38/146 (26%), Positives = 59/146 (40%), Gaps = 1/146 (0%)
 Frame = +3

Query: 60  EATAAAAISLQTSGDKLPSQVGAEGSRSLQDGGGSTWPFACSPAALYSSHNSAATAPGDA 239
           EA      SLQT G+ + + +     + +Q GG   WP   +P  + +   SA  A  D 
Sbjct: 523 EAKGTETPSLQTEGESISTSMPTGEEQGVQTGGVKKWPEVAAPQRVIT---SAGNAKIDG 579

Query: 240 GDLYRFSSIG-QGPTGAGAQSHRGPRRLLSAADLSSGVGVVQRRTRNSEATVLAEPALPC 416
              YR + +   G T    ++ RG      +   SSGV  +Q   + S      +P    
Sbjct: 580 NPGYRNARVDVDGQTVGYTRNERG-----GSQPQSSGVHTLQGSQQPSVEPSPVDPGHGA 634

Query: 417 SGSGDGEPAVQQHPASHPRRQRPTLH 494
           SG+   +P  +   A     Q P+LH
Sbjct: 635 SGAASAQPGGEAKGA-----QTPSLH 655

 Score = 38.1 bits (87), Expect = 0.093
 Identities = 37/146 (25%), Positives = 57/146 (38%), Gaps = 1/146 (0%)
 Frame = +3

Query: 60   EATAAAAISLQTSGDKLPSQVGAEGSRSLQDGGGSTWPFACSPAALYSSHNSAATAPGDA 239
            EA      SLQT G+ + + +     + +Q GG   WP   +P  + +   SA  A  D 
Sbjct: 1269 EAKGTQTPSLQTEGESISTSMPTGEEQGVQTGGVKKWPEVAAPQRVIT---SAGNAKIDG 1325

Query: 240  GDLYRFSSIG-QGPTGAGAQSHRGPRRLLSAADLSSGVGVVQRRTRNSEATVLAEPALPC 416
               YR + +   G T    ++ RG      +   SSGV   Q   +        +P    
Sbjct: 1326 NPGYRNARVDVDGQTVGYTRNERG-----GSQPQSSGVHTSQGSQQPGVEPSPVDPGHGA 1380

Query: 417  SGSGDGEPAVQQHPASHPRRQRPTLH 494
            SG+   +P  +   A     Q P+LH
Sbjct: 1381 SGAASVQPGGEAKGA-----QTPSLH 1401

 Score = 38.1 bits (87), Expect = 0.093
 Identities = 37/146 (25%), Positives = 57/146 (38%), Gaps = 1/146 (0%)
 Frame = +3

Query: 60   EATAAAAISLQTSGDKLPSQVGAEGSRSLQDGGGSTWPFACSPAALYSSHNSAATAPGDA 239
            EA      SLQT G+ + + +     + +Q GG   WP   +P  + +   SA  A  D 
Sbjct: 843  EAKGTQTPSLQTEGESISTSMPTGEEQGVQTGGVKKWPEVAAPQRVIT---SAGNAKIDG 899

Query: 240  GDLYRFSSIG-QGPTGAGAQSHRGPRRLLSAADLSSGVGVVQRRTRNSEATVLAEPALPC 416
               YR + +   G T    ++ RG      +   SSGV   Q   +        +P    
Sbjct: 900  NPGYRNARVDVDGQTVGYTRNERG-----GSQPQSSGVHTSQGSQQPGVEPSPVDPGHGA 954

Query: 417  SGSGDGEPAVQQHPASHPRRQRPTLH 494
            SG+   +P  +   A     Q P+LH
Sbjct: 955  SGAASVQPGGEAKGA-----QTPSLH 975

>sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 (cRax2) gi|6002395|dbj|BAA84749.1|
           homeobox protein cRax/Rax2/Rx2 [Gallus gallus]
          Length = 317

 Score = 40.8 bits (94), Expect = 0.014
 Identities = 38/128 (29%), Positives = 47/128 (36%), Gaps = 3/128 (2%)
 Frame = +3

Query: 126 AEGSRSLQDGGGSTWPFACSPAALYSSHNSAATAPG---DAGDLYRFSSIGQGPTGAGAQ 296
           AEG+ SL        P A SP    S  +S     G   D G L  F   G   +   A 
Sbjct: 11  AEGAFSLSA------PAARSPGGNPSRLHSIEAILGFTKDDGLLGPFQPDGGAGSAKEAA 64

Query: 297 SHRGPRRLLSAADLSSGVGVVQRRTRNSEATVLAEPALPCSGSGDGEPAVQQHPASHPRR 476
             RGPR  L            Q R +       A P LP    GDG+P+ ++ P    RR
Sbjct: 65  DKRGPRHCLPKGPAEPPPAEHQGRFQEPYCPGSASPELPAGDGGDGKPSDEEQPKKKHRR 124

Query: 477 QRPTLHAF 500
            R T   +
Sbjct: 125 NRTTFTTY 132

>gb|AAN32718.1|AF420600_1 homeobox transcription factor RAX1 [Gallus gallus]
          Length = 317

 Score = 40.8 bits (94), Expect = 0.014
 Identities = 38/128 (29%), Positives = 47/128 (36%), Gaps = 3/128 (2%)
 Frame = +3

Query: 126 AEGSRSLQDGGGSTWPFACSPAALYSSHNSAATAPG---DAGDLYRFSSIGQGPTGAGAQ 296
           AEG+ SL        P A SP    S  +S     G   D G L  F   G   +   A 
Sbjct: 11  AEGAFSLSA------PAARSPGGNPSRLHSIEAILGFTKDDGLLGPFQPDGGAGSAKEAA 64

Query: 297 SHRGPRRLLSAADLSSGVGVVQRRTRNSEATVLAEPALPCSGSGDGEPAVQQHPASHPRR 476
             RGPR  L            Q R +       A P LP    GDG+P+ ++ P    RR
Sbjct: 65  DKRGPRHCLPKGPAEPPPAEHQGRFQEPYCPGSASPELPAGDGGDGKPSDEEQPKKKHRR 124

Query: 477 QRPTLHAF 500
            R T   +
Sbjct: 125 NRTTFTTY 132

>ref|NP_499059.2| tenascin XB precursor (64.1 kD) (3K438) [Caenorhabditis elegans]
           gi|25004985|emb|CAA81587.2| Hypothetical protein
           K04H4.2a [Caenorhabditis elegans]
          Length = 628

 Score = 38.5 bits (88), Expect = 0.071
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 4/62 (6%)
 Frame = -2

Query: 550 SSESKSTSAALGCT----TDTNACSVGRCRRGWLAGCCCTAGSPSPLPLQGSAGSANTVA 383
           SS S+  ++ L CT    +++N CSVG C  G+    CC++GS S   +    GS+N V 
Sbjct: 161 SSLSRQQASGLVCTFSSCSNSNPCSVGTCNNGY----CCSSGSNSGSAIIVGGGSSNCVG 216

Query: 382 SE 377
            +
Sbjct: 217 CQ 218

>ref|NP_499058.2| tenascin XB precursor (3K438) [Caenorhabditis elegans]
           gi|28381464|sp|P34504|YMV2_CAEEL Hypothetical protein
           K04H4.2 in chromosome III gi|25004986|emb|CAA81588.2|
           Hypothetical protein K04H4.2b [Caenorhabditis elegans]
          Length = 675

 Score = 38.5 bits (88), Expect = 0.071
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 4/62 (6%)
 Frame = -2

Query: 550 SSESKSTSAALGCT----TDTNACSVGRCRRGWLAGCCCTAGSPSPLPLQGSAGSANTVA 383
           SS S+  ++ L CT    +++N CSVG C  G+    CC++GS S   +    GS+N V 
Sbjct: 161 SSLSRQQASGLVCTFSSCSNSNPCSVGTCNNGY----CCSSGSNSGSAIIVGGGSSNCVG 216

Query: 382 SE 377
            +
Sbjct: 217 CQ 218



EST assemble image


clone accession position
1 CL09g05_r AV393716 1 507
2 MXL099c08_r BP098796 108 593
3 MXL007d02_r BP093360 178 345




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research