KCC000193A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000193A_C01 KCC000193A_c01
cttacaAAGCATACTCAGATGCGCCCGACTTGTGCACCCTCGCTGAAGCGGCTTTGAACC
CGCGTGAATTCCATTTTAAGCTCGTCGTCCACACTCACGAGCAACGATGCCTAAGGCCAA
ATACAATCTATACGTGCGCCTTGTAGCGCGTGTGTTCGCTCTTTAAAGGCCCACTTACCG
AAACTTTTTGACCCGCGATTTCGCGAAGAGCTTGCGGTCTTCCCGCCTCCCACTGCTGGC
GAAGAGTGGACGTCCTAATCCCCTCATAACTCCACGCCAGGCGCCCCTGAATCGTCACGA
TGATGCACCTGGACGCCAAAGCCACAGCATAGTCTGCCTGGCTCTGGACGCAGCAAGTCT
GGGTCTAGCGCTCCCAGGCACATCACCGCCTGCCGCACCACTGCCGGTGCCTGGGGTGAA
GCCGCCGGGTGCGGCCGGCGTTGCCGCCCTCCCGCCGGGTTCCTTGCCCTTCGGCGCAGC
CACGCAGTTCGGCCAAGTCCCCTTCTTTGCGGGTCTGCCTTTTCCGCTGCCGGGCGGCGT
GCCGCCTCCGCTGCCAGGACTACCACCTTTATCATCTGCAGCGGCGCACGCGGCGGCAGC
CATGACTATCGCGCAGGCCGCGGCGGCTGCGGA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000193A_C01 KCC000193A_c01
         (633 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAF36091.1| flagelliform silk protein [Nephila madagascariensis]    52  7e-06
gb|AAK30592.1|AF350263_1 major ampullate spidroin 2 [Argiope aur...    49  5e-05
sp|P10569|MYSC_ACACA Myosin IC heavy chain gi|71609|pir||MWAXIC ...    49  6e-05
gb|AAC98089.1| myosin IC heavy chain [Acanthamoeba castellanii]        49  6e-05
ref|NP_003448.1| zinc finger protein 207 [Homo sapiens] gi|61373...    49  6e-05

>gb|AAF36091.1| flagelliform silk protein [Nephila madagascariensis]
          Length = 1884

 Score = 52.0 bits (123), Expect = 7e-06
 Identities = 32/74 (43%), Positives = 35/74 (47%), Gaps = 6/74 (8%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVA----APKGKEPGGRAATPAAPGGFTPGTGSG 397
            G PG GG  P G+G G     GT P   A     P G  PGG     + PGG+ PG G G
Sbjct: 1102 GGPGPGGYGPGGAGPGGYGPGGTGPGGSAPGGAGPGGAGPGGYGPGGSGPGGYGPGGGPG 1161

Query: 396  AA--GGDVPGSARP 361
             A  GG  PG A P
Sbjct: 1162 GAGPGGAGPGGAGP 1175

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 31/68 (45%), Positives = 33/68 (47%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
            G  G GG  P GSG G     G+ P   A P G  PGG     A PGG  PG G+G  GG
Sbjct: 1573 GGSGPGGYGPGGSGPGGYGPGGSGPGG-AGPGGAGPGGAGPGGAGPGGVGPG-GAGP-GG 1629

Query: 384  DVPGSARP 361
              PG A P
Sbjct: 1630 SGPGGAGP 1637

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 31/76 (40%), Positives = 33/76 (42%), Gaps = 3/76 (3%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP---GTGSGA 394
           G  G GG  P G G G     G  P   A P G  PGG     A PGG+TP   G G   
Sbjct: 297 GGYGPGGAGPGGYGPGGAGPGGYGPGG-AGPGGYGPGGSGTGGAGPGGYTPGGAGPGGYG 355

Query: 393 AGGDVPGSARPRLAAS 346
            GG  PG + P  A S
Sbjct: 356 PGGYGPGGSGPGGAGS 371

 Score = 45.4 bits (106), Expect = 7e-04
 Identities = 29/71 (40%), Positives = 30/71 (41%), Gaps = 3/71 (4%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP---GTGSGA 394
           G  G GG  P G+G G     G  P   A P G  PGG     A P G  P   GTG   
Sbjct: 357 GGYGPGGSGPGGAGSGGVGPGGYGPGG-AGPGGAGPGGAGPGGAGPSGAGPGGAGTGGAG 415

Query: 393 AGGDVPGSARP 361
            GG  PG A P
Sbjct: 416 TGGAGPGGAGP 426

 Score = 45.1 bits (105), Expect = 9e-04
 Identities = 30/72 (41%), Positives = 32/72 (43%), Gaps = 4/72 (5%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSG---- 397
            G  G GG  P GSG G     G  P     P G  PGG     + PGG+ PG GSG    
Sbjct: 1533 GGSGPGGYGPGGSGPGGAGPGGYGPGGTG-PGGSGPGGYGPGGSGPGGYGPG-GSGPGGY 1590

Query: 396  AAGGDVPGSARP 361
              GG  PG A P
Sbjct: 1591 GPGGSGPGGAGP 1602

 Score = 45.1 bits (105), Expect = 9e-04
 Identities = 31/76 (40%), Positives = 33/76 (42%), Gaps = 8/76 (10%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP------GTG 403
           G  G GG  P G G G     G  P   A P G  PGG     + PGG+ P      GTG
Sbjct: 728 GGAGPGGAGPGGYGPGGAGPGGYGPGG-AGPGGSGPGGIGPGGSGPGGYGPGGIGPGGTG 786

Query: 402 SGAA--GGDVPGSARP 361
            G A  GG  PG A P
Sbjct: 787 PGGAGPGGAGPGGAGP 802

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 30/72 (41%), Positives = 35/72 (47%), Gaps = 4/72 (5%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSG---- 397
            G  G+GG  P GSG G     G+ P  V  P G  PGG  +  + PGG  PG GSG    
Sbjct: 887  GGAGAGGVGPGGSGPGGVGPGGSGPGGVG-PGGSGPGGVGSGGSGPGGVGPG-GSGPGGV 944

Query: 396  AAGGDVPGSARP 361
             +GG  PG   P
Sbjct: 945  GSGGFGPGGIGP 956

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 40/104 (38%), Positives = 44/104 (41%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
            G  G GG  P GSG G     G+ P     P G  PGG     A PGG  PG G+G +G 
Sbjct: 748  GGYGPGGAGPGGSGPGGIGPGGSGPGGYG-PGGIGPGGTGPGGAGPGGAGPG-GAGPSGA 805

Query: 384  DVPGSARPRLAASRARQTMLWLWRPGASS*RFRGAWRGVMRGLG 253
              PG A P   A R       + R GA      GA RG   G G
Sbjct: 806  G-PGGAGPS-GAGRGGSGRGSVGRGGAGR---GGAGRGGAGGAG 844

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 27/71 (38%), Positives = 30/71 (42%), Gaps = 3/71 (4%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP---GTGSGA 394
           G  G GG TP G+G G     G  P       G  PGG  +    PGG+ P   G G   
Sbjct: 337 GGAGPGGYTPGGAGPGGYGPGGYGPG------GSGPGGAGSGGVGPGGYGPGGAGPGGAG 390

Query: 393 AGGDVPGSARP 361
            GG  PG A P
Sbjct: 391 PGGAGPGGAGP 401

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 30/67 (44%), Positives = 35/67 (51%), Gaps = 4/67 (5%)
 Frame = -1

Query: 555  GSGGGTPPGSGKGRPAKKGTWPNCV----AAPKGKEPGGRAATPAAPGGFTPGTGSGAAG 388
            G+GG  P G+G G     G+ P  V    + P G  PGG A  P  PGG  PG G+G AG
Sbjct: 1707 GAGGSGPGGAGPGGVGPGGSGPGGVGPGGSGPGGVGPGG-AGGPYGPGGSGPG-GAGGAG 1764

Query: 387  GDVPGSA 367
            G  PG A
Sbjct: 1765 G--PGGA 1769

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 29/71 (40%), Positives = 33/71 (45%), Gaps = 3/71 (4%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP-GTGSGAA- 391
            G  G GG  P GSG G     G+ P     P G  PGG     + PGG+ P G+G G A 
Sbjct: 1493 GGAGPGGYGPGGSGPGGYGPGGSGPGGFG-PGGSGPGGYGPGGSGPGGYGPGGSGPGGAG 1551

Query: 390  -GGDVPGSARP 361
             GG  PG   P
Sbjct: 1552 PGGYGPGGTGP 1562

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 39/105 (37%), Positives = 41/105 (38%)
 Frame = -1

Query: 567  GGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAG 388
            GG PG  G  P G+G G     G  P   A P G  PGG     A PGG  PG   GA  
Sbjct: 1157 GGGPGGAG--PGGAGPGGAGPGGAGPG-GAGPGGAGPGGAGPGGAGPGGAGPG---GAGP 1210

Query: 387  GDVPGSARPRLAASRARQTMLWLWRPGASS*RFRGAWRGVMRGLG 253
            G V      R  A R         R GA      GA RG   G+G
Sbjct: 1211 GGVGTGGLGRGGAGRGGAGRGGAGRGGAGR---GGAGRGGTGGVG 1252

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 28/71 (39%), Positives = 29/71 (40%), Gaps = 3/71 (4%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP---GTGSGA 394
            G  G GG  P G G G     G  P   + P G  PGG     A PGG  P   G G   
Sbjct: 1558 GGTGPGGSGPGGYGPGGSGPGGYGPGG-SGPGGYGPGGSGPGGAGPGGAGPGGAGPGGAG 1616

Query: 393  AGGDVPGSARP 361
             GG  PG A P
Sbjct: 1617 PGGVGPGGAGP 1627

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 29/75 (38%), Positives = 32/75 (42%), Gaps = 7/75 (9%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP------GTG 403
            G  G GG  P GSG G     G+ P  V  P G  PGG  +    PGG  P      G G
Sbjct: 907  GGSGPGGVGPGGSGPGGVGSGGSGPGGVG-PGGSGPGGVGSGGFGPGGIGPGGSGPGGVG 965

Query: 402  SGAAGGDV-PGSARP 361
             G  GG   PG + P
Sbjct: 966  PGGVGGPYGPGGSGP 980

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCV---AAPKGKEPGGRAATPAAPGGFTP---GTG 403
            G  G GG  P G G G     G  P      A P G  PGG     A PGG  P   G G
Sbjct: 1132 GGAGPGGAGPGGYGPGGSGPGGYGPGGGPGGAGPGGAGPGGAGPGGAGPGGAGPGGAGPG 1191

Query: 402  SGAAGGDVPGSARP 361
                GG  PG A P
Sbjct: 1192 GAGPGGAGPGGAGP 1205

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 3/71 (4%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP---GTGSGA 394
            G  G GG  P G G G     G  P   A P G  PGG       PGG  P   G G   
Sbjct: 1067 GGYGPGGAGPGGYGPGGAGSGGYGPGG-AGPGGYGPGGPGPGGYGPGGAGPGGYGPGGTG 1125

Query: 393  AGGDVPGSARP 361
             GG  PG A P
Sbjct: 1126 PGGSAPGGAGP 1136

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 8/76 (10%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP--------G 409
           G  G GG  P G G G     G  P   A P G  PGG       PGG  P        G
Sbjct: 277 GGYGPGGAGPGGYGPGGAGPGGYGPGG-AGPGGYGPGGAGPGGYGPGGAGPGGYGPGGSG 335

Query: 408 TGSGAAGGDVPGSARP 361
           TG    GG  PG A P
Sbjct: 336 TGGAGPGGYTPGGAGP 351

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 29/72 (40%), Positives = 31/72 (42%), Gaps = 3/72 (4%)
 Frame = -1

Query: 567 GGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP---GTGSG 397
           GG+ G GGG P G+G       G      A P G  PGG     A PGG  P   G G  
Sbjct: 690 GGAGGPGGGGPGGAG----GPYGPGGPGGAGPGGYGPGGYGPGGAGPGGAGPGGYGPGGA 745

Query: 396 AAGGDVPGSARP 361
             GG  PG A P
Sbjct: 746 GPGGYGPGGAGP 757

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 27/69 (39%), Positives = 28/69 (40%), Gaps = 3/69 (4%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGF---TPGTGSGA 394
            G  G GG  P G+G G     G  P  V  P G  PGG     A PGG      G G   
Sbjct: 1593 GGSGPGGAGPGGAGPGGAGPGGAGPGGV-GPGGAGPGGSGPGGAGPGGAGRGGAGRGGAG 1651

Query: 393  AGGDVPGSA 367
             GG  PG A
Sbjct: 1652 XGGAGPGGA 1660

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 28/68 (41%), Positives = 30/68 (43%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
           G  G GG  P GSG G     G  P   A P G  PGG     + PGG   G+G    GG
Sbjct: 322 GGAGPGGYGPGGSGTGGAGPGGYTPGG-AGPGGYGPGGYGPGGSGPGG--AGSGGVGPGG 378

Query: 384 DVPGSARP 361
             PG A P
Sbjct: 379 YGPGGAGP 386

 Score = 41.6 bits (96), Expect = 0.010
 Identities = 30/88 (34%), Positives = 37/88 (41%), Gaps = 8/88 (9%)
 Frame = -1

Query: 600 AAAACAAADDKGGSPGSGGGTPP---GSGKGRPAKKGTWPNCVAA--PKGKEPGGRAATP 436
           A++    +   GG+ G GGG+ P   G+  G+    G  P    A  P G  PGG     
Sbjct: 209 ASSGSYGSGTTGGAYGPGGGSEPFGPGAAGGQYGPGGAGPGGAGAYGPGGVGPGGAGPGG 268

Query: 435 AAPGGFTP---GTGSGAAGGDVPGSARP 361
             PGG  P   G G    GG  PG A P
Sbjct: 269 YGPGGAGPGGYGPGGAGPGGYGPGGAGP 296

 Score = 41.2 bits (95), Expect = 0.013
 Identities = 26/67 (38%), Positives = 30/67 (43%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
           G  G GG  P G+G G     G  P+  A P G   GG     A PGG  PG G+G  G 
Sbjct: 377 GGYGPGGAGPGGAGPGGAGPGGAGPS-GAGPGGAGTGGAGTGGAGPGGAGPG-GAGPGGA 434

Query: 384 DVPGSAR 364
              G+ R
Sbjct: 435 GPGGAGR 441

 Score = 41.2 bits (95), Expect = 0.013
 Identities = 29/68 (42%), Positives = 31/68 (44%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
           G  G GG  P G+G G     G  P   A P G  PGG     + PGG  PG GSG  GG
Sbjct: 718 GGYGPGGYGPGGAGPGGAGPGGYGPGG-AGPGGYGPGGAGPGGSGPGGIGPG-GSG-PGG 774

Query: 384 DVPGSARP 361
             PG   P
Sbjct: 775 YGPGGIGP 782

 Score = 41.2 bits (95), Expect = 0.013
 Identities = 30/81 (37%), Positives = 33/81 (40%), Gaps = 12/81 (14%)
 Frame = -1

Query: 567  GGSPGSGGGTPPGSGKGRPAKKGTW----PNCVAAPKGKEPGGRAATPAAPGGFTP---- 412
            GG  G GG   PG G G P  +G      P     P G  PGG     A PGG+ P    
Sbjct: 1017 GGPYGPGGPYGPG-GAGGPGGEGPGGAGGPYGPGGPGGAGPGGYGPGGAGPGGYGPGGAG 1075

Query: 411  ----GTGSGAAGGDVPGSARP 361
                G G   +GG  PG A P
Sbjct: 1076 PGGYGPGGAGSGGYGPGGAGP 1096

 Score = 40.8 bits (94), Expect = 0.016
 Identities = 28/71 (39%), Positives = 30/71 (41%), Gaps = 3/71 (4%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP---GTGSGA 394
            G  G GG  P G+G G     G  P   + P G  PGG     A PGG  P   G G   
Sbjct: 1122 GGTGPGGSAPGGAGPGGAGPGGYGPGG-SGPGGYGPGG-GPGGAGPGGAGPGGAGPGGAG 1179

Query: 393  AGGDVPGSARP 361
             GG  PG A P
Sbjct: 1180 PGGAGPGGAGP 1190

 Score = 40.4 bits (93), Expect = 0.022
 Identities = 26/71 (36%), Positives = 29/71 (40%), Gaps = 4/71 (5%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCV----AAPKGKEPGGRAATPAAPGGFTPGTGSG 397
           G  G GG  P G+G G     G  P       A   G  PGG     A PGG  PG G+G
Sbjct: 382 GGAGPGGAGPGGAGPGGAGPSGAGPGGAGTGGAGTGGAGPGGAGPGGAGPGGAGPG-GAG 440

Query: 396 AAGGDVPGSAR 364
             G    G+ R
Sbjct: 441 RGGAGRGGAGR 451

 Score = 40.4 bits (93), Expect = 0.022
 Identities = 30/68 (44%), Positives = 32/68 (46%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
           G  G GG  P G G G     G  P   A P G  PGG     A PGG+ PG G+G  GG
Sbjct: 267 GGYGPGGAGPGGYGPGGAGPGGYGPGG-AGPGGYGPGG-----AGPGGYGPG-GAG-PGG 318

Query: 384 DVPGSARP 361
             PG A P
Sbjct: 319 YGPGGAGP 326

 Score = 40.4 bits (93), Expect = 0.022
 Identities = 26/66 (39%), Positives = 30/66 (45%)
 Frame = -1

Query: 558  PGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGGDV 379
            PG  GG     G+G     G +      P G  PGG     A PGG+ PG GSG  GG  
Sbjct: 1454 PGGAGGPYGPGGEGPGGAGGPYGPGGVGPGGTGPGGYGPGGAGPGGYGPG-GSG-PGGYG 1511

Query: 378  PGSARP 361
            PG + P
Sbjct: 1512 PGGSGP 1517

 Score = 39.7 bits (91), Expect = 0.037
 Identities = 29/101 (28%), Positives = 37/101 (35%)
 Frame = -1

Query: 555 GSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGGDVP 376
           G GG  P  SG       G+ P+  +   G  P   AA  ++PGG  PG  S    G   
Sbjct: 145 GPGGVRPSASGPSGSGPSGSRPSS-SGSSGTRPSANAAGGSSPGGIAPGGSSPGGAGVSG 203

Query: 375 GSARPRLAASRARQTMLWLWRPGASS*RFRGAWRGVMRGLG 253
            +  P  + S    T    + PG  S  F     G   G G
Sbjct: 204 ATGGPASSGSYGSGTTGGAYGPGGGSEPFGPGAAGGQYGPG 244

 Score = 39.7 bits (91), Expect = 0.037
 Identities = 30/73 (41%), Positives = 34/73 (46%), Gaps = 4/73 (5%)
 Frame = -1

Query: 567  GGSPGSGGGTPPGSGKGRPAKKGTWPNCV----AAPKGKEPGGRAATPAAPGGFTPGTGS 400
            GG  G GG  P G+G G     G  P       + P G  PGG     + PGGF PG GS
Sbjct: 1472 GGPYGPGGVGPGGTGPGGYGPGGAGPGGYGPGGSGPGGYGPGG-----SGPGGFGPG-GS 1525

Query: 399  GAAGGDVPGSARP 361
            G  GG  PG + P
Sbjct: 1526 G-PGGYGPGGSGP 1537

 Score = 39.3 bits (90), Expect = 0.048
 Identities = 27/70 (38%), Positives = 30/70 (42%), Gaps = 1/70 (1%)
 Frame = -1

Query: 567  GGSPGSGGGTPPGSGKGRPAKKGTW-PNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAA 391
            GG  G+GG   PG   G     G + P     P G+ PGG A  P  PG    G G    
Sbjct: 1002 GGPGGAGGPYGPGGAGGPYGPGGPYGPGGAGGPGGEGPGG-AGGPYGPG----GPGGAGP 1056

Query: 390  GGDVPGSARP 361
            GG  PG A P
Sbjct: 1057 GGYGPGGAGP 1066

 Score = 39.3 bits (90), Expect = 0.048
 Identities = 29/70 (41%), Positives = 32/70 (45%), Gaps = 3/70 (4%)
 Frame = -1

Query: 567  GGSPGSGGGTPPGSGKGRPAKKG--TWPNCVAAPKGKEPGGRAATPAAPGG-FTPGTGSG 397
            G  PG  GG     G G P   G    P     P G  PGG A  P  PGG + PG G+G
Sbjct: 977  GSGPGGAGGAGGSYGPGGPYGPGGSGGPGGAGGPYG--PGG-AGGPYGPGGPYGPG-GAG 1032

Query: 396  AAGGDVPGSA 367
              GG+ PG A
Sbjct: 1033 GPGGEGPGGA 1042

 Score = 39.3 bits (90), Expect = 0.048
 Identities = 29/79 (36%), Positives = 31/79 (38%), Gaps = 10/79 (12%)
 Frame = -1

Query: 567 GGSPGSGGGTPPGSGKGRP-------AKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP- 412
           GG  G GG  P G+G   P       A  G +    A P G  PGG       PGG  P 
Sbjct: 238 GGQYGPGGAGPGGAGAYGPGGVGPGGAGPGGYGPGGAGPGGYGPGGAGPGGYGPGGAGPG 297

Query: 411 --GTGSGAAGGDVPGSARP 361
             G G    GG  PG A P
Sbjct: 298 GYGPGGAGPGGYGPGGAGP 316

 Score = 38.9 bits (89), Expect = 0.063
 Identities = 29/75 (38%), Positives = 31/75 (40%), Gaps = 4/75 (5%)
 Frame = -1

Query: 579  ADDKGGSPGSGGGTPPGSGKGRPAKKGTWPNCVA---APKGKEPGGRAATPAAPGGFTPG 409
            A   GG+ G GG   PG   G     G  P        P G+ PGG A  P  PGG    
Sbjct: 1763 AGGPGGAYGPGGSGGPGGAGGPYGPGGEGPGGAGGPYGPGGEGPGG-AGGPYGPGGAGGP 1821

Query: 408  TGSGAAGGDV-PGSA 367
             G G AGG   PG A
Sbjct: 1822 YGPGGAGGPYGPGGA 1836

 Score = 38.9 bits (89), Expect = 0.063
 Identities = 28/71 (39%), Positives = 29/71 (40%), Gaps = 4/71 (5%)
 Frame = -1

Query: 567  GGSPGSGGGT--PPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSG- 397
            G  PG  GG   P GSG G     G  P     P G    G A  P  PGG  PG   G 
Sbjct: 1334 GVGPGGAGGPYRPGGSGPGGAGGAGG-PGGAYGPGGSGGPGGAGGPYGPGGEGPGGSGGP 1392

Query: 396  -AAGGDVPGSA 367
               GG+ PG A
Sbjct: 1393 YGPGGEGPGGA 1403

 Score = 38.9 bits (89), Expect = 0.063
 Identities = 28/70 (40%), Positives = 29/70 (41%), Gaps = 4/70 (5%)
 Frame = -1

Query: 558  PGSGGGTPPGS-GKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP---GTGSGAA 391
            PG  GG  PG  G G     G  P   A P G  PGG  +    PGG  P   G G    
Sbjct: 1048 PGGPGGAGPGGYGPGGAGPGGYGPG-GAGPGGYGPGGAGSGGYGPGGAGPGGYGPGGPGP 1106

Query: 390  GGDVPGSARP 361
            GG  PG A P
Sbjct: 1107 GGYGPGGAGP 1116

 Score = 38.9 bits (89), Expect = 0.063
 Identities = 28/71 (39%), Positives = 29/71 (40%), Gaps = 4/71 (5%)
 Frame = -1

Query: 567  GGSPGSGGGT--PPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSG- 397
            G  PG  GG   P GSG G     G  P     P G    G A  P  PGG  PG   G 
Sbjct: 1740 GVGPGGAGGPYGPGGSGPGGAGGAGG-PGGAYGPGGSGGPGGAGGPYGPGGEGPGGAGGP 1798

Query: 396  -AAGGDVPGSA 367
               GG+ PG A
Sbjct: 1799 YGPGGEGPGGA 1809

 Score = 38.1 bits (87), Expect = 0.11
 Identities = 27/78 (34%), Positives = 33/78 (41%), Gaps = 13/78 (16%)
 Frame = -1

Query: 555 GSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP-----------G 409
           GSG G P G+G   P+  G +     AP G  PGG   + + P G  P           G
Sbjct: 117 GSGAGQPSGAG---PSGTGGYAPTGYAPSGSGPGGVRPSASGPSGSGPSGSRPSSSGSSG 173

Query: 408 T--GSGAAGGDVPGSARP 361
           T   + AAGG  PG   P
Sbjct: 174 TRPSANAAGGSSPGGIAP 191

 Score = 38.1 bits (87), Expect = 0.11
 Identities = 29/75 (38%), Positives = 31/75 (40%), Gaps = 4/75 (5%)
 Frame = -1

Query: 579  ADDKGGSPGSGGGTPPGSGKGRPAKKGTWPNCVA---APKGKEPGGRAATPAAPGGFTPG 409
            A   GG+ G GG   PG   G     G  P        P G+ PGG A  P  PGG    
Sbjct: 1357 AGGPGGAYGPGGSGGPGGAGGPYGPGGEGPGGSGGPYGPGGEGPGG-AGGPYGPGGAGGP 1415

Query: 408  TGSGAAGGDV-PGSA 367
             G G AGG   PG A
Sbjct: 1416 YGPGGAGGPYGPGGA 1430

 Score = 38.1 bits (87), Expect = 0.11
 Identities = 26/68 (38%), Positives = 30/68 (43%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
            G  G+GG   PG   G     G  P     P G  PGG       PGG+ PG G+G  GG
Sbjct: 1444 GPGGAGGPYGPGGAGGPYGPGGEGPGGAGGPYG--PGGVGPGGTGPGGYGPG-GAG-PGG 1499

Query: 384  DVPGSARP 361
              PG + P
Sbjct: 1500 YGPGGSGP 1507

 Score = 38.1 bits (87), Expect = 0.11
 Identities = 43/132 (32%), Positives = 53/132 (39%), Gaps = 15/132 (11%)
 Frame = -1

Query: 579 ADDKGGSPGSGGG---------TPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAP 427
           +   GG  G GGG         T  GSG G+P+  G       AP G  P G     + P
Sbjct: 92  SSSSGGGGGGGGGPVITETLTVTVGGSGAGQPSGAGPSGTGGYAPTGYAPSG-----SGP 146

Query: 426 GGFTPG----TGSGAAGG--DVPGSARPRLAASRARQTMLWLWRPGASS*RFRGAWRGVM 265
           GG  P     +GSG +G      GS+  R +A+ A  +      PG SS        GV 
Sbjct: 147 GGVRPSASGPSGSGPSGSRPSSSGSSGTRPSANAAGGSSPGGIAPGGSS----PGGAGVS 202

Query: 264 RGLGRPLFASSG 229
              G P  ASSG
Sbjct: 203 GATGGP--ASSG 212

 Score = 38.1 bits (87), Expect = 0.11
 Identities = 29/69 (42%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = -1

Query: 567 GGSPGSGGGTPPGSGKGRPAKKGTW-PNCVAAPKGKEPGGRAATPAAPGG-FTPGTGSGA 394
           GG  G GG   PG   G     G + P     P G  PGG A  P  PGG + PG G+G 
Sbjct: 639 GGPYGPGGSGGPGGAGGPYGPGGPYGPGGAGGPYG--PGG-AGGPYGPGGPYGPG-GAGG 694

Query: 393 AGGDVPGSA 367
            GG  PG A
Sbjct: 695 PGGGGPGGA 703

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 24/66 (36%), Positives = 28/66 (42%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
           G  G GG  P GSG+G     G+ P  V +       G    P  PGG  PG   GA G 
Sbjct: 589 GGSGQGGLGPGGSGQGGLGPGGSGPGGVGS-------GGVGGPYGPGGSGPGGVGGAGGP 641

Query: 384 DVPGSA 367
             PG +
Sbjct: 642 YGPGGS 647

 Score = 37.0 bits (84), Expect = 0.24
 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 1/67 (1%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
            G P   GG  PG   G     G  P     P G  PGG A  P  PGG     G G AGG
Sbjct: 1782 GGPYGPGGEGPGGAGGPYGPGGEGPGGAGGPYG--PGG-AGGPYGPGGAGGPYGPGGAGG 1838

Query: 384  DV-PGSA 367
               PG A
Sbjct: 1839 PYGPGGA 1845

 Score = 37.0 bits (84), Expect = 0.24
 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 1/67 (1%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
            G P   GG  PG   G     G  P     P G  PGG A  P  PGG     G G AGG
Sbjct: 1376 GGPYGPGGEGPGGSGGPYGPGGEGPGGAGGPYG--PGG-AGGPYGPGGAGGPYGPGGAGG 1432

Query: 384  DV-PGSA 367
               PG A
Sbjct: 1433 PYGPGGA 1439

 Score = 36.6 bits (83), Expect = 0.31
 Identities = 28/72 (38%), Positives = 32/72 (43%), Gaps = 9/72 (12%)
 Frame = -1

Query: 555  GSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGR---------AATPAAPGGFTPGTG 403
            G+GG  P G+G G     G+ P       G  PGG          A  P  PGG  PG G
Sbjct: 1301 GAGGSGPGGAGPGGVGPGGSGPG------GVGPGGSGPGGVGPGGAGGPYRPGGSGPG-G 1353

Query: 402  SGAAGGDVPGSA 367
            +G AGG  PG A
Sbjct: 1354 AGGAGG--PGGA 1363

 Score = 36.6 bits (83), Expect = 0.31
 Identities = 24/66 (36%), Positives = 25/66 (37%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
            G  G GG  P GSG G     G  P  V  P G    G      A G + PG   G  G 
Sbjct: 947  GGFGPGGIGPGGSGPG-----GVGPGGVGGPYGPGGSGPGGAGGAGGSYGPGGPYGPGGS 1001

Query: 384  DVPGSA 367
              PG A
Sbjct: 1002 GGPGGA 1007

 Score = 36.6 bits (83), Expect = 0.31
 Identities = 28/71 (39%), Positives = 30/71 (41%), Gaps = 3/71 (4%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTW-PNCVAAPKGKEPGGRAAT--PAAPGGFTPGTGSGA 394
           G  G+GG   PG   G     G + P     P G  PGG      P  PGG  PG G G 
Sbjct: 664 GPGGAGGPYGPGGAGGPYGPGGPYGPGGAGGPGGGGPGGAGGPYGPGGPGGAGPG-GYGP 722

Query: 393 AGGDVPGSARP 361
            GG  PG A P
Sbjct: 723 -GGYGPGGAGP 732

 Score = 35.8 bits (81), Expect = 0.53
 Identities = 25/71 (35%), Positives = 29/71 (40%), Gaps = 3/71 (4%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP---GTGSGA 394
           G  G+GG  P G+G G     G  P   + P G  PGG       PGG      G G   
Sbjct: 519 GGAGAGGSGPGGAGPG-----GVGPG-RSGPGGVGPGGSGPGSVGPGGSGQGGLGIGRSG 572

Query: 393 AGGDVPGSARP 361
            GG  PG + P
Sbjct: 573 PGGVGPGGSGP 583

 Score = 35.8 bits (81), Expect = 0.53
 Identities = 32/105 (30%), Positives = 35/105 (32%), Gaps = 25/105 (23%)
 Frame = -1

Query: 606  VMAAAACAAADDKGGSPGSGGGTP-----------------------PGSGKGRPAKKGT 496
            V  A     A   GG+ GSGG T                         G+G G     G 
Sbjct: 1251 VGGAGGAGGAGGVGGAGGSGGTTVIEDLDITIDGADGPITISEELTISGAGAGGSGPGGA 1310

Query: 495  WPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSG--AAGGDVPGSA 367
             P  V  P G  PGG     + PGG  PG   G    GG  PG A
Sbjct: 1311 GPGGV-GPGGSGPGGVGPGGSGPGGVGPGGAGGPYRPGGSGPGGA 1354

 Score = 35.8 bits (81), Expect = 0.53
 Identities = 26/68 (38%), Positives = 27/68 (39%), Gaps = 8/68 (11%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPG-------- 409
            G  G GG  P G G G     G+ P   A P G   GG     A  GG  PG        
Sbjct: 1608 GGAGPGGAGPGGVGPGGAGPGGSGPGG-AGPGGAGRGGAGRGGAGXGGAGPGGAGGAGGA 1666

Query: 408  TGSGAAGG 385
             GSG AGG
Sbjct: 1667 GGSGGAGG 1674

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 25/75 (33%), Positives = 29/75 (38%), Gaps = 7/75 (9%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCV----AAPKGKEPGGRAATPAAPGGFTP---GT 406
           G  G GG  P GSG G     G+    +    + P G  PGG       PGG      G 
Sbjct: 539 GRSGPGGVGPGGSGPGSVGPGGSGQGGLGIGRSGPGGVGPGGSGPGSIGPGGSGQGGLGP 598

Query: 405 GSGAAGGDVPGSARP 361
           G    GG  PG + P
Sbjct: 599 GGSGQGGLGPGGSGP 613

 Score = 33.1 bits (74), Expect = 3.4
 Identities = 21/60 (35%), Positives = 25/60 (41%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
           G  G GG  P G+G+G   + G      A   G   GG     A  GG     G+G AGG
Sbjct: 427 GGAGPGGAGPGGAGRGGAGRGG------AGRGGAGRGGAGRGGAGRGGAGGAGGAGGAGG 480

 Score = 32.7 bits (73), Expect = 4.5
 Identities = 28/75 (37%), Positives = 28/75 (37%), Gaps = 6/75 (8%)
 Frame = -1

Query: 567  GGSPGSGGGTPPGSGKGRPAKKGT-----WPNCVAAPKGKEPGGRAATPAAPGGFTPGTG 403
            G  PG  GG     G G P   G       P     P G  PGG A  P  PGG     G
Sbjct: 1803 GEGPGGAGGPYGPGGAGGPYGPGGAGGPYGPGGAGGPYG--PGG-AGGPYGPGGAGGPYG 1859

Query: 402  SGAAGGDV-PGSARP 361
             G AGG   PG   P
Sbjct: 1860 PGGAGGPYGPGGEGP 1874

 Score = 32.7 bits (73), Expect = 4.5
 Identities = 28/75 (37%), Positives = 28/75 (37%), Gaps = 6/75 (8%)
 Frame = -1

Query: 567  GGSPGSGGGTPPGSGKGRPAKKGT-----WPNCVAAPKGKEPGGRAATPAAPGGFTPGTG 403
            G  PG  GG     G G P   G       P     P G  PGG A  P  PGG     G
Sbjct: 1397 GEGPGGAGGPYGPGGAGGPYGPGGAGGPYGPGGAGGPYG--PGG-AGGPYGPGGAGGPYG 1453

Query: 402  SGAAGGDV-PGSARP 361
             G AGG   PG   P
Sbjct: 1454 PGGAGGPYGPGGEGP 1468

 Score = 32.3 bits (72), Expect = 5.9
 Identities = 23/61 (37%), Positives = 25/61 (40%), Gaps = 1/61 (1%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGF-TPGTGSGAAG 388
           G  G+GG  P G+G G     G  P   A   G   GG     A  GG    G G G AG
Sbjct: 412 GGAGTGGAGPGGAGPGGAGPGGAGPG-GAGRGGAGRGGAGRGGAGRGGAGRGGAGRGGAG 470

Query: 387 G 385
           G
Sbjct: 471 G 471

 Score = 32.0 bits (71), Expect = 7.7
 Identities = 23/67 (34%), Positives = 27/67 (39%)
 Frame = -1

Query: 564 GSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAGG 385
           G  G+GG    G+G G     G      A P G  PGG     A  GG   G G+G  G 
Sbjct: 407 GGAGTGGAGTGGAGPGGAGPGG------AGPGGAGPGGAGRGGAGRGGAGRG-GAGRGGA 459

Query: 384 DVPGSAR 364
              G+ R
Sbjct: 460 GRGGAGR 466

 Score = 29.3 bits (64), Expect(2) = 9.7
 Identities = 26/76 (34%), Positives = 26/76 (34%)
 Frame = +2

Query: 374  PGTSPPAAPLPVPGVKPPGAAGVAALPPGSLPFGAATQFGQVPFFAGLPFPLPGGVPPPL 553
            PG  P  A    PG   PG AG     PG    G A   G  P  AG     PGG  P  
Sbjct: 1156 PGGGPGGAG---PGGAGPGGAGPGGAGPGGAGPGGAGPGGAGPGGAGPGGAGPGGAGPGG 1212

Query: 554  PGLPPLSSAAAHAAAA 601
             G   L    A    A
Sbjct: 1213 VGTGGLGRGGAGRGGA 1228

 Score = 20.8 bits (42), Expect(2) = 9.7
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +1

Query: 589  RGGSHDYRAGRGGCG 633
            RGG+    AGRGG G
Sbjct: 1225 RGGAGRGGAGRGGAG 1239

>gb|AAK30592.1|AF350263_1 major ampullate spidroin 2 [Argiope aurantia]
          Length = 349

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 31/77 (40%), Positives = 37/77 (47%), Gaps = 2/77 (2%)
 Frame = -1

Query: 594 AACAAADDKGGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEP--GGRAATPAAPGG 421
           AA AAA   G  PG+G   P G+G+  P  +G        P G+ P   G AA  AA GG
Sbjct: 19  AAAAAAAAGGYGPGAGQQGPXGAGQQGPGSQGPGGAGQQGPGGQGPYGPGAAAAAAAVGG 78

Query: 420 FTPGTGSGAAGGDVPGS 370
           + PG G    G   PGS
Sbjct: 79  YGPGAGQQGPGSQGPGS 95

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 31/79 (39%), Positives = 35/79 (44%), Gaps = 2/79 (2%)
 Frame = -1

Query: 600 AAAACAAADDKGGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGG--RAATPAAP 427
           AAAA AAA          GG  PG+G+  P  +G        P G  P G   AA  AA 
Sbjct: 111 AAAAAAAA----------GGYGPGAGQQGPGSQGPGSGGQQGPGGLGPYGPSAAAAAAAA 160

Query: 426 GGFTPGTGSGAAGGDVPGS 370
           GG+ PG G    G   PGS
Sbjct: 161 GGYGPGAGQQGPGSQGPGS 179

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 31/79 (39%), Positives = 35/79 (44%), Gaps = 2/79 (2%)
 Frame = -1

Query: 600 AAAACAAADDKGGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGG--RAATPAAP 427
           AAAA AAA          GG  PG+G+  P  +G        P G  P G   AA  AA 
Sbjct: 153 AAAAAAAA----------GGYGPGAGQQGPGSQGPGSGGQQRPGGLGPYGPSAAAAAAAA 202

Query: 426 GGFTPGTGSGAAGGDVPGS 370
           GG+ PG G    G   PGS
Sbjct: 203 GGYGPGAGQQGPGSQGPGS 221

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 30/77 (38%), Positives = 35/77 (44%), Gaps = 2/77 (2%)
 Frame = -1

Query: 594 AACAAADDKGGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGG--RAATPAAPGG 421
           AA AAA   G  PG+G   P   G G   ++G        P G+ P G   AA  AA GG
Sbjct: 69  AAAAAAAVGGYGPGAGQQGPGSQGPGSGGQQG--------PGGQGPYGPSAAAAAAAAGG 120

Query: 420 FTPGTGSGAAGGDVPGS 370
           + PG G    G   PGS
Sbjct: 121 YGPGAGQQGPGSQGPGS 137

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 33/91 (36%), Positives = 41/91 (44%), Gaps = 4/91 (4%)
 Frame = -1

Query: 600 AAAACAAADDKGGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGG--RAATPAAP 427
           AAAA AAA          GG  PG+G+  P  +G        P G  P G   AA  AA 
Sbjct: 195 AAAAAAAA----------GGYGPGAGQQGPGSQGPGSGGQQRPGGLGPYGPSAAAAAAAA 244

Query: 426 GGFTPGTGSGAAGGDVP--GSARPRLAASRA 340
           GG+ PG G    G   P   +A  RL++ +A
Sbjct: 245 GGYGPGAGQQGPGSQAPVASAAASRLSSPQA 275

>sp|P10569|MYSC_ACACA Myosin IC heavy chain gi|71609|pir||MWAXIC myosin heavy chain IC -
            Acanthamoeba castellanii gi|155625|gb|AAA27707.1| myosin
            IB heavy chain
          Length = 1168

 Score = 48.9 bits (115), Expect = 6e-05
 Identities = 31/70 (44%), Positives = 35/70 (49%), Gaps = 1/70 (1%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGK-GRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAG 388
            G PG GG  PPG+G+ G P  +G     + AP G  P GR A P   GG  PG G G  G
Sbjct: 1077 GGPGRGGAPPPGAGRAGPPGGRG-----MPAPGGAAPRGRGAPPPGAGG-PPGGGRG--G 1128

Query: 387  GDVPGSARPR 358
               PG  R R
Sbjct: 1129 APPPGGMRGR 1138

 Score = 38.1 bits (87), Expect = 0.11
 Identities = 26/71 (36%), Positives = 28/71 (38%), Gaps = 3/71 (4%)
 Frame = -1

Query: 561  SPGSGGG---TPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAA 391
            +PG  GG    PPG   GR A  G  P  +    G  PGG     A P G       G  
Sbjct: 1040 APGPSGGPRPAPPGGKSGRAAPMGG-PGPMRGRGGPAPGGPGRGGAPPPGAGRAGPPGGR 1098

Query: 390  GGDVPGSARPR 358
            G   PG A PR
Sbjct: 1099 GMPAPGGAAPR 1109

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 26/73 (35%), Positives = 28/73 (37%), Gaps = 3/73 (4%)
 Frame = -1

Query: 582  AADDKGGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPG-- 409
            AA    G+P  G G PPG G+G            A P G   G     PA PGG   G  
Sbjct: 1106 AAPRGRGAPPPGAGGPPGGGRGG-----------APPPGGMRGRGGPGPAPPGGMARGGM 1154

Query: 408  -TGSGAAGGDVPG 373
                G AG   PG
Sbjct: 1155 MPPRGRAGPPPPG 1167

 Score = 32.0 bits (71), Expect = 7.7
 Identities = 29/99 (29%), Positives = 37/99 (37%), Gaps = 2/99 (2%)
 Frame = -1

Query: 570  KGGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP--GTGSG 397
            +G   G  G  P    +  P      P     P+   PGG++   A  GG  P  G G  
Sbjct: 1015 EGELNGQRGVFPASYVELIPRAAAPAPGPSGGPRPAPPGGKSGRAAPMGGPGPMRGRGGP 1074

Query: 396  AAGGDVPGSARPRLAASRARQTMLWLWRPGASS*RFRGA 280
            A GG   G A P  A          +  PG ++ R RGA
Sbjct: 1075 APGGPGRGGAPPPGAGRAGPPGGRGMPAPGGAAPRGRGA 1113

>gb|AAC98089.1| myosin IC heavy chain [Acanthamoeba castellanii]
          Length = 1186

 Score = 48.9 bits (115), Expect = 6e-05
 Identities = 31/70 (44%), Positives = 35/70 (49%), Gaps = 1/70 (1%)
 Frame = -1

Query: 564  GSPGSGGGTPPGSGK-GRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAAG 388
            G PG GG  PPG+G+ G P  +G     + AP G  P GR A P   GG  PG G G  G
Sbjct: 1095 GGPGRGGAPPPGAGRAGPPGGRG-----MPAPGGAAPRGRGAPPPGAGG-PPGGGRG--G 1146

Query: 387  GDVPGSARPR 358
               PG  R R
Sbjct: 1147 APPPGGMRGR 1156

 Score = 38.1 bits (87), Expect = 0.11
 Identities = 26/71 (36%), Positives = 28/71 (38%), Gaps = 3/71 (4%)
 Frame = -1

Query: 561  SPGSGGG---TPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPGTGSGAA 391
            +PG  GG    PPG   GR A  G  P  +    G  PGG     A P G       G  
Sbjct: 1058 APGPSGGPRPAPPGGKSGRAAPMGG-PGPMRGRGGPAPGGPGRGGAPPPGAGRAGPPGGR 1116

Query: 390  GGDVPGSARPR 358
            G   PG A PR
Sbjct: 1117 GMPAPGGAAPR 1127

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 26/73 (35%), Positives = 28/73 (37%), Gaps = 3/73 (4%)
 Frame = -1

Query: 582  AADDKGGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTPG-- 409
            AA    G+P  G G PPG G+G            A P G   G     PA PGG   G  
Sbjct: 1124 AAPRGRGAPPPGAGGPPGGGRGG-----------APPPGGMRGRGGPGPAPPGGMARGGM 1172

Query: 408  -TGSGAAGGDVPG 373
                G AG   PG
Sbjct: 1173 MPPRGRAGPPPPG 1185

 Score = 32.0 bits (71), Expect = 7.7
 Identities = 29/99 (29%), Positives = 37/99 (37%), Gaps = 2/99 (2%)
 Frame = -1

Query: 570  KGGSPGSGGGTPPGSGKGRPAKKGTWPNCVAAPKGKEPGGRAATPAAPGGFTP--GTGSG 397
            +G   G  G  P    +  P      P     P+   PGG++   A  GG  P  G G  
Sbjct: 1033 EGELNGQRGVFPASYVELIPRAAAPAPGPSGGPRPAPPGGKSGRAAPMGGPGPMRGRGGP 1092

Query: 396  AAGGDVPGSARPRLAASRARQTMLWLWRPGASS*RFRGA 280
            A GG   G A P  A          +  PG ++ R RGA
Sbjct: 1093 APGGPGRGGAPPPGAGRAGPPGGRGMPAPGGAAPRGRGA 1131

>ref|NP_003448.1| zinc finger protein 207 [Homo sapiens]
           gi|6137311|sp|O43670|Z207_HUMAN Zinc finger protein 207
           gi|2895870|gb|AAC78561.1| zinc finger transcription
           factor [Homo sapiens]
          Length = 478

 Score = 48.9 bits (115), Expect = 6e-05
 Identities = 35/89 (39%), Positives = 47/89 (52%), Gaps = 12/89 (13%)
 Frame = +2

Query: 365 LALPGTSP-PAAPLPVPGVKPPGAAGVAALPPG------SLPFGAATQFGQVPFFAGLPF 523
           +A PG  P P AP   PG+ PP   GV  L PG       +P G     G +P   G+P 
Sbjct: 142 MAQPGLPPVPGAPGMPPGI-PPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPP 200

Query: 524 PLPG---GVPPPL--PGLPPLSSAAAHAA 595
            +PG   G+PPP+  PG+PP++ A A +A
Sbjct: 201 LMPGMPPGMPPPVPRPGIPPMTQAQAVSA 229

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 24/58 (41%), Positives = 32/58 (54%), Gaps = 1/58 (1%)
 Frame = +2

Query: 398 PLPVPGVKP-PGAAGVAALPPGSLPFGAATQFGQVPFFAGLPFPLPGGVPPPLPGLPP 568
           P+  PG+ P PGA G   +PPG +P          P   G+P PL  G+PP +PG+PP
Sbjct: 141 PMAQPGLPPVPGAPG---MPPG-IP----------PLMPGVP-PLMPGMPPVMPGMPP 183



EST assemble image


clone accession position
1 HCL058f02_r AV642816 1 407
2 LCL039g12_r AV628305 7 457
3 HCL067c08_r AV643304 10 456
4 HCL088e08_r AV644439 14 429
5 CL12b04_r AV393846 14 460
6 CL09f05_r AV393714 151 643




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research