KCC000192A_c01_1
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000192A_C01_1 KCC000192A_c01_1
cctctacaactgtgtcagcgtgcgtgaggacaaagcaaggtcacgtaattgcgacgagtc
aaagcttgcgactcgtcaccAGGTCGGCAGCTCACCTAAAGTGGTCCATACATTCCATAC
ACAATATGACTGGCGACCATGGCCACCCGGAGGCCGAAGTGTTCCCACCCCCTGACTCTA
TAGTTGCGAAGGCCCACGTTCGTGGGCTAGCGCAATATAAGGAAATGTACGAGCGCAGCA
TCACGGACTCCGACGATTTTTGGGCGGAGCAAGCCGAAGCCCTTCACTGGAACAAGGGAT
GGAGCGCGCCGTTGTGCCAGTCCAACATCAACGTGGAGAACGGGCCTGTGCACATTTCCT
GGTTTGTTGGCGCCGAGACCAACATGGCCTACAACTGCCTGGATCGCCACATTGAGGCGG
GGCATGGCGACCGTGTGGCGATATTTTGGGAGGGCAATGACGAGGGCGAGGAGCGCGTGC
TGACGTGGCTCCGTTCCAGGTGGGTGCATTTTGTGGGTTTCGCGTTGTCGCGGCGAATGG
CAGCAGCCTAGTTGCGAGCTGGAACGCGTCCGCCCCTGCAAGCGGCAGCAGTCTCCACGA
CACTCGGACTCCGTTTGGCGTGCCGAATGCGGAGCAGCGTGGAGCGCGCA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000192A_C01_1 KCC000192A_c01_1
         (650 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAE02031.1| OSJNBb0118P14.22 [Oryza sativa (japonica cultiva...   107  2e-22
ref|NP_198504.1| acetyl-CoA synthetase (acetate-CoA ligase), put...   101  8e-21
gb|AAB92552.1| acetyl-CoA synthetase [Arabidopsis thaliana]           100  2e-20
dbj|BAC03849.1| unnamed protein product [Homo sapiens]                 97  3e-19
emb|CAA67130.1| acetyl-CoA synthetase [Solanum tuberosum]              97  3e-19

>emb|CAE02031.1| OSJNBb0118P14.22 [Oryza sativa (japonica cultivar-group)]
           gi|32487908|emb|CAE05367.1| OJ000315_02.12 [Oryza sativa
           (japonica cultivar-group)]
          Length = 771

 Score =  107 bits (266), Expect = 2e-22
 Identities = 49/133 (36%), Positives = 79/133 (58%), Gaps = 1/133 (0%)
 Frame = +3

Query: 93  HLKWSIHSIHNMTGDHGHPEAEVFPPPDSIVAKAHVRGLAQYKEMYERSITDSDDFWAEQ 272
           +L++   S  ++ G  G  +A V     ++V          Y+EMY RSI D   FW+E 
Sbjct: 151 YLQFEARSDPSIAGRRGADKARVADSDGAVV----------YQEMYRRSIDDPAGFWSEI 200

Query: 273 AEALHWNKGWSAP-LCQSNINVENGPVHISWFVGAETNMAYNCLDRHIEAGHGDRVAIFW 449
           AE  +W   W+   +C  N++V  GP+ I WF G +TN+ YN +DR++EAG G+++A++W
Sbjct: 201 AETFYWKHKWNPDEVCTENLDVTKGPIKIEWFKGGKTNICYNAVDRNVEAGDGEKIAMYW 260

Query: 450 EGNDEGEERVLTW 488
           EGN+ G++  LT+
Sbjct: 261 EGNEPGQDAKLTY 273

>ref|NP_198504.1| acetyl-CoA synthetase (acetate-CoA ligase), putative [Arabidopsis
           thaliana] gi|8953708|dbj|BAA98066.1| acetyl-CoA
           synthetase [Arabidopsis thaliana]
           gi|15028047|gb|AAK76554.1| putative acetyl-CoA
           synthetase [Arabidopsis thaliana]
           gi|26983904|gb|AAN86204.1| putative acetyl-CoA
           synthetase [Arabidopsis thaliana]
          Length = 693

 Score =  101 bits (252), Expect = 8e-21
 Identities = 45/113 (39%), Positives = 67/113 (58%)
 Frame = +3

Query: 150 EAEVFPPPDSIVAKAHVRGLAQYKEMYERSITDSDDFWAEQAEALHWNKGWSAPLCQSNI 329
           E ++  P      +A V    QY EM++RS+ D   FW++ A   +W + W   +   N+
Sbjct: 38  ENDLVFPSKEFSGQALVSSPQQYMEMHKRSMDDPAAFWSDIASEFYWKQKWGDQVFSENL 97

Query: 330 NVENGPVHISWFVGAETNMAYNCLDRHIEAGHGDRVAIFWEGNDEGEERVLTW 488
           +V  GP+ I WF G  TN+ YNCLD+++EAG GD+ AI WEGN+ G +  LT+
Sbjct: 98  DVRKGPISIEWFKGGITNICYNCLDKNVEAGLGDKTAIHWEGNELGVDASLTY 150

>gb|AAB92552.1| acetyl-CoA synthetase [Arabidopsis thaliana]
          Length = 693

 Score =  100 bits (248), Expect = 2e-20
 Identities = 44/113 (38%), Positives = 66/113 (57%)
 Frame = +3

Query: 150 EAEVFPPPDSIVAKAHVRGLAQYKEMYERSITDSDDFWAEQAEALHWNKGWSAPLCQSNI 329
           E ++  P      +A V    QY EM++RS+ D   FW++ A   +W + W   +   N+
Sbjct: 38  ENDLVFPSKEFSGQALVSSPQQYMEMHKRSMDDPAAFWSDIASEFYWKQKWGDQVFSENL 97

Query: 330 NVENGPVHISWFVGAETNMAYNCLDRHIEAGHGDRVAIFWEGNDEGEERVLTW 488
           +V  GP+ I WF G  TN+ YNCLD+++E G GD+ AI WEGN+ G +  LT+
Sbjct: 98  DVRKGPISIEWFKGGITNICYNCLDKNVEXGLGDKTAIHWEGNELGVDASLTY 150

>dbj|BAC03849.1| unnamed protein product [Homo sapiens]
          Length = 714

 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 46/131 (35%), Positives = 72/131 (54%), Gaps = 7/131 (5%)
 Frame = +3

Query: 117 IHNMTGDHGHPEAEV------FPPPDSIVAKAHVRGLAQYKEMYERSITDSDDFWAEQAE 278
           + + +G  G  EA        + PP  +   AHV  L +Y+E++ RS+ +  +FW + A+
Sbjct: 8   VRSGSGSRGQEEAGAGGRARSWSPPPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAK 67

Query: 279 ALHWNKGWSAPLCQSNINVENGPVHISWFVGAETNMAYNCLDRHI-EAGHGDRVAIFWEG 455
             +W      PL + N +V  G + I W  GA TN+ YN LDR++ E   GD+VA +WEG
Sbjct: 68  EFYWKTPCPGPLLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEG 127

Query: 456 NDEGEERVLTW 488
           N+ GE   +T+
Sbjct: 128 NEPGETTQITY 138

>emb|CAA67130.1| acetyl-CoA synthetase [Solanum tuberosum]
          Length = 631

 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 38/88 (43%), Positives = 56/88 (63%)
 Frame = +3

Query: 225 MYERSITDSDDFWAEQAEALHWNKGWSAPLCQSNINVENGPVHISWFVGAETNMAYNCLD 404
           MY+RS+ D   FW++ A   +W + W   +   N +V  G + I WF G  TN+ YNCLD
Sbjct: 1   MYQRSVHDPSGFWSDIASEFYWREKWGQQVYHENFDVRKGKIKIEWFKGGMTNICYNCLD 60

Query: 405 RHIEAGHGDRVAIFWEGNDEGEERVLTW 488
           R+IE+G GD+ AI+WEGN+ G +  +T+
Sbjct: 61  RNIESGKGDKTAIYWEGNEPGLDSSMTY 88



EST assemble image


clone accession position
1 CL09f01_r AV393710 1 539
2 LCL094e02_r AV631461 341 623




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research