KCC000189A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000189A_C01 KCC000189A_c01
CTTACCCACCCAACCTCGCGTTATTCCTTTTGAACCAAAGAACCGACCCGAACACGATTG
CGTTAATACTCGGCTTCACCGGGGCGGCACCATTTAAAGGCCCTATAGCTTTGATATTTT
CACTCGTCGCTCGGTAGCAGCCTAGCCAGACAGGGTACCGTTGGCCGCCACAGCAGCGCC
CCGTTTTGGGGCATTCGCTTCATGTGCGGCTTGAGACCGGGGCCCCACCGTTAGCCTTCA
CGGCCCGGAGTTATTTCGTCATTATCAAAGATGGAGGGCGAGGGGCTGCAACCGGTGGAG
ATATACAGCACCGGGACCACCACCTACTCGCGGTATGATGTGGTGCTCGGACGTGGTGCA
TTCAAGACGGTGTTCCGTGCTTTTGACGAAGAGGAGGGCATCGAAGTGGCCTGGAATCAG
ATCAAGGTCAACGATCTGGCGTCCTCGCCCGCGGAGCGGGAGCGCCTGTGGGCTGAAATT
CGTGTGCTCAAGCAGCTCAAGCACAAGAACATTATGACCTTCTACGACTCGTGGCTCGAC
AACAAGAACAACACGGTCAACTTCATCACAGAGCTGTTTACGTCCGGCACGCTCCGGCAG
TATCGGAAAAAGCATAAGCATATCGATGAGCAAGTGCTGAAGCGCTGGGCGTGGCAGATC
CTGCAAGGCCTGGTGTACCTGCACGGCCACAATCCGCCCATCATCCATCGCGACCTCAAA
TGCGACAACATCTTCGTGAATGGAACCTCGGGAGTCATCAAAATTGGCGACCTGGGTCTG
GTGACGCTATGCCGCGGCTTCACGGCGCCGCAGTCGGTGCTGGGCACGCCCGAGTTCATG
GCGCCGGAGCTGTATGAGGAGAAATACGACGAGAAGGTGGACGTGTACTCGTTCGGCATG
TGCCTGCTGGAGCTGGCGACCATGGAGTACCCATACTCGGAGTGCAAGAACGCGGCGCAG
ATCTACAAGAAGGTCACGCAGGGCATTCACCCCGGCGGCCTATCCAAGGTGGAGGGGCAG
AACCTTCGGGAGTTCATCCAGGTCTGCATCCAGCACGACCCCAACCAGCGACCGGAGGCC
CGCCAGCTGCTGAAGCACCCCTTTTTTGAGTCCATCCGCGCGCAGCTCAGCTGCGGCGGC
ATGGACCGTGTCCCGGTGGACCGGACAGTGGGTACGGCCGATGAGGCCACGCCAGTGGGG
AACGTGACCCCAGAGGTGGGGTCGGACGAGGAGCAGCCGGCGGCGCGACCGGCGGTGGGG
TCGTCGCCGCAGGCTGCTGCCGCTGCTGCCGCTGGGAACGGGCAAGTGACGAGGGCCGGG
AGCTTTGCGGACGGGGGCGAGGCGGAGGCGCCGATGCGGGCACCCTCGCCCGGCCTACCC
ATGGCGCGGGCGCCGTCGCCTGGGCTGCCCTCCGGCGGGCCGATGCGGGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000189A_C01 KCC000189A_c01
         (1431 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAC84087.1| ZIK1 protein [Medicago sativa]                        359  6e-98
dbj|BAB91130.1| Ser/Thr kinase [Arabidopsis thaliana]                 337  2e-91
ref|NP_188505.1| protein kinase family [Arabidopsis thaliana] gi...   337  2e-91
dbj|BAB08432.1| MAP kinase [Arabidopsis thaliana]                     337  2e-91
ref|NP_568599.1| protein kinase family [Arabidopsis thaliana] gi...   337  2e-91

>emb|CAC84087.1| ZIK1 protein [Medicago sativa]
          Length = 591

 Score =  359 bits (922), Expect = 6e-98
 Identities = 168/266 (63%), Positives = 207/266 (77%)
 Frame = +1

Query: 316  TTTYSRYDVVLGRGAFKTVFRAFDEEEGIEVAWNQIKVNDLASSPAERERLWAEIRVLKQ 495
            T  Y RY  +LG+GAFK V+RAFDE EGIEVAWNQ+KV+DL  +  + ERL++E+ +LK 
Sbjct: 22   TGRYGRYKEILGKGAFKKVYRAFDELEGIEVAWNQVKVSDLLRNSEDLERLYSEVHLLKT 81

Query: 496  LKHKNIMTFYDSWLDNKNNTVNFITELFTSGTLRQYRKKHKHIDEQVLKRWAWQILQGLV 675
            LKHKNI+ FY+SW+D KN  +NFITE+FTSGTLRQYRKKHKH+D + LK+W+ QIL+GL 
Sbjct: 82   LKHKNIIKFYNSWVDTKNENINFITEIFTSGTLRQYRKKHKHVDLRALKKWSRQILEGLS 141

Query: 676  YLHGHNPPIIHRDLKCDNIFVNGTSGVIKIGDLGLVTLCRGFTAPQSVLGTPEFMAPELY 855
            YLH HNPP+IHRDLKCDNIFVNG  G +KIGDLGL  + +  T+  SV+GTPEFMAP LY
Sbjct: 142  YLHSHNPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAILQQATSAHSVIGTPEFMAPXLY 201

Query: 856  EEKYDEKVDVYSFGMCLLELATMEYPYSECKNAAQIYKKVTQGIHPGGLSKVEGQNLREF 1035
            EE+Y+E VD+Y+FGMCLLEL T+EYPY EC NAAQIYKKVT GI P  L+KV    ++ F
Sbjct: 202  EEEYNELVDIYAFGMCLLELVTVEYPYVECANAAQIYKKVTSGIKPASLAKVNDPEVKAF 261

Query: 1036 IQVCIQHDPNQRPEARQLLKHPFFES 1113
            I+ C  H   + P A+ LL  PF +S
Sbjct: 262  IEKCTAHVTERLP-AKALLMDPFLQS 286

>dbj|BAB91130.1| Ser/Thr kinase [Arabidopsis thaliana]
          Length = 550

 Score =  337 bits (865), Expect = 2e-91
 Identities = 159/260 (61%), Positives = 202/260 (77%)
 Frame = +1

Query: 325  YSRYDVVLGRGAFKTVFRAFDEEEGIEVAWNQIKVNDLASSPAERERLWAEIRVLKQLKH 504
            Y RYD VLGRGAFKTV++AFDE +GIEVAWN + + D+   P + ERL++E+ +LK LKH
Sbjct: 15   YIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKH 74

Query: 505  KNIMTFYDSWLDNKNNTVNFITELFTSGTLRQYRKKHKHIDEQVLKRWAWQILQGLVYLH 684
            +NI+  + SW+D KN T+N ITELFTSG+LR YRKKH+ +D + +K WA QIL+GL YLH
Sbjct: 75   ENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLH 134

Query: 685  GHNPPIIHRDLKCDNIFVNGTSGVIKIGDLGLVTLCRGFTAPQSVLGTPEFMAPELYEEK 864
              NPP+IHRDLKCDNIFVNG +G +KIGDLGL T+ +  TA +SV+GTPEFMAPELYEE+
Sbjct: 135  SQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTA-RSVIGTPEFMAPELYEEE 193

Query: 865  YDEKVDVYSFGMCLLELATMEYPYSECKNAAQIYKKVTQGIHPGGLSKVEGQNLREFIQV 1044
            Y+E VD+YSFGMC+LE+ T EYPY+EC+N AQIYKKVT  I P  L KV+   +R+FI+ 
Sbjct: 194  YNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEK 253

Query: 1045 CIQHDPNQRPEARQLLKHPF 1104
            C+    + RP A +L K PF
Sbjct: 254  CLL-PASSRPTALELSKDPF 272

>ref|NP_188505.1| protein kinase family [Arabidopsis thaliana]
            gi|20302604|dbj|BAB91129.1| Ser/Thr kinase [Arabidopsis
            thaliana]
          Length = 567

 Score =  337 bits (865), Expect = 2e-91
 Identities = 157/265 (59%), Positives = 206/265 (77%)
 Frame = +1

Query: 316  TTTYSRYDVVLGRGAFKTVFRAFDEEEGIEVAWNQIKVNDLASSPAERERLWAEIRVLKQ 495
            T  Y RY  V+G+GAFKTV++AFDE +GIEVAWNQ++++D+  SP   ERL++E+R+LK 
Sbjct: 24   TFRYIRYKEVIGKGAFKTVYKAFDEVDGIEVAWNQVRIDDVLQSPNCLERLYSEVRLLKS 83

Query: 496  LKHKNIMTFYDSWLDNKNNTVNFITELFTSGTLRQYRKKHKHIDEQVLKRWAWQILQGLV 675
            LKH NI+ FY+SW+D+KN TVN ITELFTSG+LR YRKKH+ ++ + +K WA QIL GL 
Sbjct: 84   LKHNNIIRFYNSWIDDKNKTVNIITELFTSGSLRHYRKKHRKVNMKAVKNWARQILMGLR 143

Query: 676  YLHGHNPPIIHRDLKCDNIFVNGTSGVIKIGDLGLVTLCRGFTAPQSVLGTPEFMAPELY 855
            YLHG  PPIIHRDLKCDNIF+NG  G +KIGDLGL T+     A +SV+GTPEFMAPELY
Sbjct: 144  YLHGQEPPIIHRDLKCDNIFINGNHGEVKIGDLGLATVMEQANA-KSVIGTPEFMAPELY 202

Query: 856  EEKYDEKVDVYSFGMCLLELATMEYPYSECKNAAQIYKKVTQGIHPGGLSKVEGQNLREF 1035
            +E Y+E  D+YSFGMC+LE+ T +YPY ECKN+AQIYKKV+ GI P  LS+V+   +++F
Sbjct: 203  DENYNELADIYSFGMCMLEMVTFDYPYCECKNSAQIYKKVSSGIKPASLSRVKDPEVKQF 262

Query: 1036 IQVCIQHDPNQRPEARQLLKHPFFE 1110
            I+ C+    ++R  A++LL  PF +
Sbjct: 263  IEKCLL-PASERLSAKELLLDPFLQ 286

>dbj|BAB08432.1| MAP kinase [Arabidopsis thaliana]
          Length = 608

 Score =  337 bits (865), Expect = 2e-91
 Identities = 159/260 (61%), Positives = 202/260 (77%)
 Frame = +1

Query: 325  YSRYDVVLGRGAFKTVFRAFDEEEGIEVAWNQIKVNDLASSPAERERLWAEIRVLKQLKH 504
            Y RYD VLGRGAFKTV++AFDE +GIEVAWN + + D+   P + ERL++E+ +LK LKH
Sbjct: 73   YIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKH 132

Query: 505  KNIMTFYDSWLDNKNNTVNFITELFTSGTLRQYRKKHKHIDEQVLKRWAWQILQGLVYLH 684
            +NI+  + SW+D KN T+N ITELFTSG+LR YRKKH+ +D + +K WA QIL+GL YLH
Sbjct: 133  ENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLH 192

Query: 685  GHNPPIIHRDLKCDNIFVNGTSGVIKIGDLGLVTLCRGFTAPQSVLGTPEFMAPELYEEK 864
              NPP+IHRDLKCDNIFVNG +G +KIGDLGL T+ +  TA +SV+GTPEFMAPELYEE+
Sbjct: 193  SQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTA-RSVIGTPEFMAPELYEEE 251

Query: 865  YDEKVDVYSFGMCLLELATMEYPYSECKNAAQIYKKVTQGIHPGGLSKVEGQNLREFIQV 1044
            Y+E VD+YSFGMC+LE+ T EYPY+EC+N AQIYKKVT  I P  L KV+   +R+FI+ 
Sbjct: 252  YNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEK 311

Query: 1045 CIQHDPNQRPEARQLLKHPF 1104
            C+    + RP A +L K PF
Sbjct: 312  CLL-PASSRPTALELSKDPF 330

>ref|NP_568599.1| protein kinase family [Arabidopsis thaliana]
            gi|15983509|gb|AAL11622.1|AF424629_1 AT5g41990/MJC20_9
            [Arabidopsis thaliana] gi|21360469|gb|AAM47350.1|
            AT5g41990/MJC20_9 [Arabidopsis thaliana]
          Length = 563

 Score =  337 bits (865), Expect = 2e-91
 Identities = 159/260 (61%), Positives = 202/260 (77%)
 Frame = +1

Query: 325  YSRYDVVLGRGAFKTVFRAFDEEEGIEVAWNQIKVNDLASSPAERERLWAEIRVLKQLKH 504
            Y RYD VLGRGAFKTV++AFDE +GIEVAWN + + D+   P + ERL++E+ +LK LKH
Sbjct: 28   YIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKH 87

Query: 505  KNIMTFYDSWLDNKNNTVNFITELFTSGTLRQYRKKHKHIDEQVLKRWAWQILQGLVYLH 684
            +NI+  + SW+D KN T+N ITELFTSG+LR YRKKH+ +D + +K WA QIL+GL YLH
Sbjct: 88   ENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLH 147

Query: 685  GHNPPIIHRDLKCDNIFVNGTSGVIKIGDLGLVTLCRGFTAPQSVLGTPEFMAPELYEEK 864
              NPP+IHRDLKCDNIFVNG +G +KIGDLGL T+ +  TA +SV+GTPEFMAPELYEE+
Sbjct: 148  SQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTA-RSVIGTPEFMAPELYEEE 206

Query: 865  YDEKVDVYSFGMCLLELATMEYPYSECKNAAQIYKKVTQGIHPGGLSKVEGQNLREFIQV 1044
            Y+E VD+YSFGMC+LE+ T EYPY+EC+N AQIYKKVT  I P  L KV+   +R+FI+ 
Sbjct: 207  YNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEK 266

Query: 1045 CIQHDPNQRPEARQLLKHPF 1104
            C+    + RP A +L K PF
Sbjct: 267  CLL-PASSRPTALELSKDPF 285



EST assemble image


clone accession position
1 HCL098c12_r AV645109 1 387
2 CL30h05_r AV394752 1 497
3 LCL067g03_r AV629856 4 327
4 LCL093e09_r AV631416 8 426
5 MXL025b01_r BP094571 9 478
6 LCL043c03_r AV628523 13 436
7 CL49h11_r AV397714 17 531
8 CL09d12_r AV393741 296 779
9 LCL046f02_r AV628752 324 858
10 LCL027c11_r AV627477 354 704
11 LCL084g06_r AV630819 396 888
12 LCL041g07_r AV628430 502 779
13 LCL059a06_r AV629453 552 996
14 LCL087c02_r AV630983 698 1162
15 MXL089c02_r BP098200 709 1064
16 LCL098f04_r AV631715 966 1431




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research