KCC000187A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000187A_C02 KCC000187A_c02
CATATTCAGCAAAAATGGTGCGCATCAGCGTCCTGGGCGATGCCCTGAAGACCATGTACA
ACGGCTGAGAAGCGCGGCAAGCGCCAGGTGCTGCTGCGCCCCGCCTCCAAGGTGGTCATC
AAGTTCCTGTCGCTGATGATGAAGCACGGCTACATTGGCGAGTTCGAGTACGTCGACGAC
CACCGCTCGGGCAAGATTGTCGTCGAGCTGAACGGCCGCCTGAACAAGTGCGGTGTCATC
TCTCCCCGCTACGACATCGGCCACTCCGAGATTGAGCGCTGGGTGGCCCGCCTGCTGCCT
TCTCGTCAGTTCGGCATCATTGTCATGACCACCTCGGCCGGCATCATGGACCACGAGGAG
GCCCGCCGCAAGCGTGTCGGTGGCAAGGTGCTGGGCTTCTTCTACTGAGCAGCTGGACCT
GGCGCGCTGGAGCAGCATGCGGGTCTGGGATCTTGTGAGCCGAGGGCGATGCGGGGAGGA
TAGCGTGCAGTTTGCAGCCGGCGTCAGCTTCGCTGCTACTCGCAGCCAAAGCAGCGTCGG
TCTGGCTGGAGCTATTAGCGCTCGGCGCCTAGCTTTCTCGGAGGACTTAAGAGGCGGCCT
TTTGGGGGCAGGGGCGAGGAGCAGGGGAGGGCGGACGGCTCCGCTGTCGTCCTGCGTATA
CCAGACTTTCAGCGAGCTGTAACGGCTGAGAAAGTGAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000187A_C02 KCC000187A_c02
         (764 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC57277.1| ribosomal protein S15 [Oryza sativa (japonica cu...   205  7e-55
ref|NP_172256.1| 40S ribosomal protein S15A (RPS15aA) [Arabidops...   205  1e-54
gb|AAK30203.1|AF349962_1 cytoplasmic ribosomal protein S15a [Dau...   206  2e-54
ref|NP_190190.1| 40S ribosomal protein S15A (RPS15aD) [Arabidops...   206  2e-54
dbj|BAA89231.1| wrp15a [Citrullus lanatus]                            204  3e-54

>dbj|BAC57277.1| ribosomal protein S15 [Oryza sativa (japonica cultivar-group)]
          Length = 130

 Score =  205 bits (521), Expect(2) = 7e-55
 Identities = 98/114 (85%), Positives = 106/114 (92%)
 Frame = +1

Query: 64  AEKRGKRQVLLRPASKVVIKFLSLMMKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS 243
           AEKRGKRQVL+RP+SKV+IKFL +M KHGYIGEFE+VDDHRSGKIVVELNGRLNKCGVIS
Sbjct: 17  AEKRGKRQVLIRPSSKVIIKFLIVMQKHGYIGEFEFVDDHRSGKIVVELNGRLNKCGVIS 76

Query: 244 PRYDIGHSEIERWVARLLPSRQFGIIVMTTSAGIMDHEEARRKRVGGKVLGFFY 405
           PR+D+G  EIE W ARLLPSRQFG IV+TTSAGIMDHEEARRK VGGKVLGFFY
Sbjct: 77  PRFDVGVKEIESWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130

 Score = 32.0 bits (71), Expect(2) = 7e-55
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +3

Query: 15 MVRISVLGDALKTMYN 62
          MVR+SVL DALKTMYN
Sbjct: 1  MVRVSVLNDALKTMYN 16

>ref|NP_172256.1| 40S ribosomal protein S15A (RPS15aA) [Arabidopsis thaliana]
           gi|15238544|ref|NP_200793.1| 40S ribosomal protein S15A
           (RPS15aF) [Arabidopsis thaliana]
           gi|1173218|sp|P42798|RS1A_ARATH 40S ribosomal protein
           S15A gi|25294591|pir||B86213 hypothetical protein
           [imported] - Arabidopsis thaliana
           gi|440824|gb|AAA61608.1| ribosomal protein S15
           gi|2150130|gb|AAB58750.1| cytoplasmic ribosomal protein
           S15a [Arabidopsis thaliana]
           gi|8439890|gb|AAF75076.1|AC007583_12 Strong similarity
           to 40S ribosomal protein S15A from Arabidopsis thaliana
           gb|L27461.  EST gb|R30315 comes from this gene
           gi|9757906|dbj|BAB08353.1| 40S ribosomal protein S15A
           [Arabidopsis thaliana]
           gi|12083302|gb|AAG48810.1|AF332447_1 putative ribosomal
           protein S15 [Arabidopsis thaliana]
           gi|13430744|gb|AAK25994.1|AF360284_1 putative ribosomal
           protein S15 [Arabidopsis thaliana]
           gi|14334968|gb|AAK59661.1| putative cytoplasmic
           ribosomal protein S15a [Arabidopsis thaliana]
           gi|14423370|gb|AAK62367.1|AF386922_1 40S ribosomal
           protein S15A [Arabidopsis thaliana]
           gi|14596085|gb|AAK68770.1| Putative 40S ribosomal
           protein S15A [Arabidopsis thaliana]
           gi|15293213|gb|AAK93717.1| putative ribosomal protein
           S15 [Arabidopsis thaliana] gi|17104627|gb|AAL34202.1|
           putative cytoplasmic ribosomal protein S15a [Arabidopsis
           thaliana] gi|20148287|gb|AAM10034.1| similar to 40S
           ribosomal protein S15A [Arabidopsis thaliana]
           gi|20148721|gb|AAM10251.1| similar to 40S ribosomal
           protein S15A [Arabidopsis thaliana]
           gi|21593169|gb|AAM65118.1| cytoplasmic ribosomal protein
           S15a-like [Arabidopsis thaliana]
           gi|21593909|gb|AAM65874.1| cytoplasmic ribosomal protein
           S15a-like [Arabidopsis thaliana]
           gi|23397065|gb|AAN31818.1| putative cytoplasmic
           ribosomal protein S15a [Arabidopsis thaliana]
          Length = 130

 Score =  205 bits (522), Expect(2) = 1e-54
 Identities = 98/114 (85%), Positives = 106/114 (92%)
 Frame = +1

Query: 64  AEKRGKRQVLLRPASKVVIKFLSLMMKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS 243
           AEKRGKRQV++RP+SKV+IKFL +M KHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS
Sbjct: 17  AEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS 76

Query: 244 PRYDIGHSEIERWVARLLPSRQFGIIVMTTSAGIMDHEEARRKRVGGKVLGFFY 405
           PR+D+G  EIE W ARLLPSRQFG IV+TTSAGIMDHEEARRK VGGKVLGFFY
Sbjct: 77  PRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130

 Score = 30.8 bits (68), Expect(2) = 1e-54
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +3

Query: 15 MVRISVLGDALKTMYN 62
          MVRISVL DALK+MYN
Sbjct: 1  MVRISVLNDALKSMYN 16

>gb|AAK30203.1|AF349962_1 cytoplasmic ribosomal protein S15a [Daucus carota]
          Length = 130

 Score =  206 bits (524), Expect(2) = 2e-54
 Identities = 99/114 (86%), Positives = 106/114 (92%)
 Frame = +1

Query: 64  AEKRGKRQVLLRPASKVVIKFLSLMMKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS 243
           AEKRGKRQV++RP+SKVVIKFL +M KHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS
Sbjct: 17  AEKRGKRQVMIRPSSKVVIKFLMVMQKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS 76

Query: 244 PRYDIGHSEIERWVARLLPSRQFGIIVMTTSAGIMDHEEARRKRVGGKVLGFFY 405
           PR+D+G  EIE W ARLLPSRQFG IV+TTSAGIMDHEEARRK VGGKVLGFFY
Sbjct: 77  PRFDVGVKEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130

 Score = 28.9 bits (63), Expect(2) = 2e-54
 Identities = 12/16 (75%), Positives = 15/16 (93%)
 Frame = +3

Query: 15 MVRISVLGDALKTMYN 62
          MVR+SVL DALK+M+N
Sbjct: 1  MVRVSVLNDALKSMFN 16

>ref|NP_190190.1| 40S ribosomal protein S15A (RPS15aD) [Arabidopsis thaliana]
           gi|11276560|pir||T49245 cytoplasmic ribosomal protein
           S15a-like - Arabidopsis thaliana
           gi|7798992|emb|CAB90931.1| cytoplasmic ribosomal protein
           S15a-like [Arabidopsis thaliana]
           gi|15027961|gb|AAK76511.1| putative cytoplasmic
           ribosomal protein S15a [Arabidopsis thaliana]
           gi|20259193|gb|AAM14312.1| putative cytoplasmic
           ribosomal protein S15a [Arabidopsis thaliana]
          Length = 130

 Score =  206 bits (523), Expect(2) = 2e-54
 Identities = 98/114 (85%), Positives = 106/114 (92%)
 Frame = +1

Query: 64  AEKRGKRQVLLRPASKVVIKFLSLMMKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS 243
           AEKRGKRQV++RP+SKV+IKFL +M KHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS
Sbjct: 17  AEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS 76

Query: 244 PRYDIGHSEIERWVARLLPSRQFGIIVMTTSAGIMDHEEARRKRVGGKVLGFFY 405
           PR+D+G  EIE W ARLLPSRQFG IV+TTSAGIMDHEEARRK VGGKVLGFFY
Sbjct: 77  PRFDVGVKEIEGWTARLLPSRQFGFIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130

 Score = 29.3 bits (64), Expect(2) = 2e-54
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = +3

Query: 15 MVRISVLGDALKTMYN 62
          MVRISVL D LK+MYN
Sbjct: 1  MVRISVLNDGLKSMYN 16

>dbj|BAA89231.1| wrp15a [Citrullus lanatus]
          Length = 130

 Score =  204 bits (519), Expect(2) = 3e-54
 Identities = 97/114 (85%), Positives = 106/114 (92%)
 Frame = +1

Query: 64  AEKRGKRQVLLRPASKVVIKFLSLMMKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVIS 243
           AEKRGKRQV++RP+SKV+IKFL +M KHGYIGEFE+VDDHRSGKIVVELNGRLNKCGVIS
Sbjct: 17  AEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEFVDDHRSGKIVVELNGRLNKCGVIS 76

Query: 244 PRYDIGHSEIERWVARLLPSRQFGIIVMTTSAGIMDHEEARRKRVGGKVLGFFY 405
           PR+D+G  EIE W ARLLPSRQFG IV+TTSAGIMDHEEARRK VGGKVLGFFY
Sbjct: 77  PRFDVGVKEIEGWTARLLPSRQFGFIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130

 Score = 30.4 bits (67), Expect(2) = 3e-54
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = +3

Query: 15 MVRISVLGDALKTMYN 62
          MVR+SVL DALK+MYN
Sbjct: 1  MVRVSVLNDALKSMYN 16



EST assemble image


clone accession position
1 HC045e11_r AV635374 1 576
2 MX034c09_r BP087427 95 466
3 MX034f05_r BP087440 101 495
4 HC097f01_r AV639301 105 509
5 MX023e05_r BP087037 105 478
6 MX007b12_r BP086357 106 501
7 HC099e12_r AV639452 108 526
8 CL36g05_r AV395132 112 602
9 HCL077b09_r AV643853 112 597
10 MXL032a11_r BP094905 112 502
11 HC098f06_r AV639380 116 457
12 CM087b07_r AV392475 123 654
13 CL62b11_r AV396426 271 763
14 CL09c04_r AV393727 279 801
15 CL32e11_r AV394881 295 773
16 CM086h06_r AV392512 360 880




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research