KCC000186A_c04
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000186A_C04 KCC000186A_c04
GCACCAGGCCACACTCACTGCAGTCACTGAGCAAAAATGGTGCTGGCACAACAACGTTGT
CCCTGAACAACCACTTCAAGAAGAAGTGGCAGTTCTATGTTGAAGACTTGGTTCAACCAG
CCTGCTCGCAATGGAGCGCCGCCGGGCTGCTCGCTGCTAAGAAGTGCCGAGGCTCAGTTC
CCTCGCCCGGCCGCCGGCCTGCTGCGCCCCATTGTTCGCTGGCGCAGACCCTGAAGTACA
ACACCAAGCAGCTGCATTGGCAAGGGCTTCACCCTGTGACGAGCTGAAGTGAGTGCTGGT
GATCCCTGTGCGCATGGCTGGCCAGCCCTGGGCATCGCCATCGACCACCGCCGCCGCAAC
AAGTCGCTGGAGAGCCTGCAGGCAGAACGCTCAGCGTCTGAAGGCTTACCGCAGCAACCT
GGTCGTCTTCCCGCGCAATGTCAAGAAGCCGAAGGCTTTCGAGACCCCTCTGGCCGATGT
GCGAACTGCGGTCGCCCAGGTCAAGGGCGCCGTGGTCCTGCCCCTGGGTCAAGGCCGCGC
CGGCGCTGGAGACCGTCAATGGTCACCAGCGAGATGAAGGCCACCGCGGGCAAGGAGCTG
GCCGAGATCAAGGCCACCGCCTACGCCAAGCTGCGCCTGGAGCGCATGAACGTACGGCAG
GTGGGCCCCCGCGCCAAGAAGGCCAAGGAGGCTGCCAAGGAGGAGGCCTCGTAAGCGGCT
CCCGCCATCAGCAGCACCTGCGGCGTCTCCGGCTTCGGGTTTGGGTTGCTCGTCAGAGGG
CCCGGGCCCGGGCCGGCTTGGCGTGGTGGTGGCGCTCCCCGGCGCGGCGGCATCGGCGGC
AGCAGCAGCGGCGTAGTCGCGGCGACTGCGGCAGTAGCAGCAACGGCGTTGGAGGAGGCG
GCAGCAGCAGCGGCAGCGGCGGACGCTGGTGGCGCTCGGGCCTAAGCGCGGCGTGGCGCG
TTGGACTGGCAGCGGCCGTGTCGTGAGTGGGTGCGGGGGCAGCAGTGGTCACCGCGGGCT
GCGGGGGAAGAGGTCTTCTGCAGGCGCGCGGGGGAAGGGGAAGCCACCCCGCACAGCTCG
GGCGGGGCGGGCGACAACCGCGCGGGCGTGGTTGGGCCACGCAAGTCACTACTGTGTTCA
GTAACTGGGTGTGTCATGCGGCAGCACGGCTAGAGACAGATGCTATTATTCGGTGCGGGT
TGAGTGTATGCCGGCTTTCTGCGTGGAGCTGTGTGCTTTGCCTGCTGCCCCGTTTCTCAA
CAAACAGCCACGCACTACAGGCGAGTGGTGGTGGTTGCTTGGCGGGCGCATGCGGCGTGG
CCCCGGATACAGTGGAAATCTCAATGGTCGTGGCTGTGGGTTTTGCGTGCGGCGGGCGGT
CCGGTTGCCCTTGCTTGGGTTATAGCGGTGTAGCCGGGCAGGGTCCGGAGTGTCAGTCGT
AGCGTGTAACTGGTGATGCACTCag


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000186A_C04 KCC000186A_c04
         (1465 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAD28610.1| 60S ribosomal protein L13 [Polytomella sp. Pring...   102  2e-20
sp|O48513|RL13_CHLSW 60S RIBOSOMAL PROTEIN L13 (BBC1 PROTEIN HOM...    97  1e-18
emb|CAC81268.1| putative cold-induced protein [Oryza sativa (ind...    94  5e-18
dbj|BAA92738.1| ESTs AU077873(S1878),D40121(S1878) correspond to...    91  5e-17
sp|P49627|RL13_TOBAC 60S RIBOSOMAL PROTEIN L13 (CLONE 6.2.1) gi|...    90  1e-16

>emb|CAD28610.1| 60S ribosomal protein L13 [Polytomella sp. Pringsheim 198.80]
          Length = 207

 Score =  102 bits (254), Expect = 2e-20
 Identities = 79/206 (38%), Positives = 107/206 (51%), Gaps = 5/206 (2%)
 Frame = +1

Query: 100 LKTWFNQPARNGAPPGCSLLRSAEAQ-----FPRPAAGLLRPIVRWRRP*STTPSSCIGK 264
           +KTWFNQ AR          RSA A+     FPRP AG L+PIV  +          +G+
Sbjct: 21  VKTWFNQAARK------LRRRSARAEKAKKVFPRPVAGSLKPIVHGQTV-KYNSKLRLGR 73

Query: 265 GFTL*RAEVSAGDPCAHGWPALGIAIDHRRRNKSLESLQAERSASEGLPQQPGRLPAQCQ 444
           GFTL  AE+      A   P +GI++D+RRRNKS+E LQ   +  +         P   +
Sbjct: 74  GFTL--AELKEAGIPAKFAPTIGISVDYRRRNKSVEGLQENANRLKAYRSNLVIFPRNVK 131

Query: 445 EAEGFRDPSGRCANCGRPGQGRRGPAPGSRPRRRWRPSMVTSEMKATAGKELAEIKATAY 624
           + + F   +   A+  +        A    P  R +P++ T+ + A    E+ E  A  Y
Sbjct: 132 KPKAFEASAEEKASAAQF-------AGEILPIARCKPTVETAAITA----EMKEFNA--Y 178

Query: 625 AKLRLERMNVRQVGPRAKKAKEAAKE 702
           AKLR+ERMNVRQVGPR KK+KEAAKE
Sbjct: 179 AKLRVERMNVRQVGPRVKKSKEAAKE 204

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 55/167 (32%), Positives = 76/167 (44%), Gaps = 5/167 (2%)
 Frame = +2

Query: 47  HNNVVPEQPLQEEVAVLC*RLGSTSLLAMERRRAARC*EVPRLSSLARPPACCAPLFAGA 226
           HNNVVP    +++      +          RRR+AR  +  ++    RP A         
Sbjct: 4   HNNVVPNNHFKKKWQFYV-KTWFNQAARKLRRRSARAEKAKKV--FPRPVAGSLKPIVHG 60

Query: 227 DPEVQHQAAALARASPCDELK*VLVIPVRMAGQPWASPSTTAAATSRWR-----ACRQNA 391
                +    L R     ELK    IP + A      P+   +   R R       ++NA
Sbjct: 61  QTVKYNSKLRLGRGFTLAELK-EAGIPAKFA------PTIGISVDYRRRNKSVEGLQENA 113

Query: 392 QRLKAYRSNLVVFPRNVKKPKAFETPLADVRTAVAQVKGAVVLPLGQ 532
            RLKAYRSNLV+FPRNVKKPKAFE   A+ + + AQ  G  +LP+ +
Sbjct: 114 NRLKAYRSNLVIFPRNVKKPKAFEAS-AEEKASAAQFAGE-ILPIAR 158

>sp|O48513|RL13_CHLSW 60S RIBOSOMAL PROTEIN L13 (BBC1 PROTEIN HOMOLOG)
           gi|2662188|dbj|BAA23724.1| BBC1 protein [Chlamydomonas
           sp. W80]
          Length = 208

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 72/203 (35%), Positives = 104/203 (50%), Gaps = 1/203 (0%)
 Frame = +1

Query: 100 LKTWFNQPARNGAPPGCSLLRSAEAQFPRPAAGLLRPIVRWRRP*STTPSSCIGKGFTL* 279
           +KTWFNQPAR            A+A FPRP AG L+PIVR +     T    +G+GFTL 
Sbjct: 21  VKTWFNQPARKQRRRNARA-EKAKATFPRPVAGSLKPIVRCQTVKYNTKQR-LGRGFTLE 78

Query: 280 RAEVSAGDPCAHGWPALGIAIDHRRRNKSLESLQAERSASEGLPQQPGRLPAQCQEAEGF 459
             +  AG P     P +GIA+DHRR+N+SLE+LQA     +         P   ++ + F
Sbjct: 79  ELK-EAGIPAKFA-PTVGIAVDHRRKNRSLETLQANVQRLKTYRASLVIFPRNMKKPKAF 136

Query: 460 RDPSGRCANCGRPGQGRRGPAPGSRPRRRWRPSMVTSEMKATAGKELAEIKATAYAKLRL 639
              +  C+   +  +G   P  G++P        +T++MK          + + Y KLR+
Sbjct: 137 EASAADCSAASQ-AKGELLPLKGTKPALEL--VKITADMK----------EGSQYGKLRI 183

Query: 640 ERMNVRQVGPRAKK-AKEAAKEE 705
           ER+N R  G R K+ A EAAK++
Sbjct: 184 ERVNARLKGMREKRAADEAAKKD 206

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 49/137 (35%), Positives = 62/137 (44%), Gaps = 6/137 (4%)
 Frame = +2

Query: 134 ERRRAARC*EVPRLSSLARPPACCAPLFAGADPEVQHQAAALARASPCDELK*VLVIPVR 313
           +RRR AR  +    ++  RP A              +    L R    +ELK        
Sbjct: 32  QRRRNARAEKAK--ATFPRPVAGSLKPIVRCQTVKYNTKQRLGRGFTLEELK-------- 81

Query: 314 MAGQPWASPSTTAAATSRWRACRQ------NAQRLKAYRSNLVVFPRNVKKPKAFETPLA 475
            AG P     T   A    R  R       N QRLK YR++LV+FPRN+KKPKAFE   A
Sbjct: 82  EAGIPAKFAPTVGIAVDHRRKNRSLETLQANVQRLKTYRASLVIFPRNMKKPKAFEASAA 141

Query: 476 DVRTAVAQVKGAVVLPL 526
           D  +A +Q KG  +LPL
Sbjct: 142 DC-SAASQAKGE-LLPL 156

 Score = 38.9 bits (89), Expect = 0.24
 Identities = 26/63 (41%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +3

Query: 66  NNHFKKKWQFYVED-LVQPACSQWSAAGLLAAKKCRGSVPSPGRRPAAPHCSLAQTLKYN 242
           N HF KKWQF+V+    QPA  Q        A+K + + P P      P     QT+KYN
Sbjct: 10  NGHFHKKWQFHVKTWFNQPARKQRRRNA--RAEKAKATFPRPVAGSLKP-IVRCQTVKYN 66

Query: 243 TKQ 251
           TKQ
Sbjct: 67  TKQ 69

>emb|CAC81268.1| putative cold-induced protein [Oryza sativa (indica
           cultivar-group)] gi|32493112|gb|AAP85547.1| ribosomal
           protein large subunit 13 [Oryza sativa (japonica
           cultivar-group)]
          Length = 208

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 76/209 (36%), Positives = 105/209 (49%)
 Frame = +1

Query: 79  RRSGSSMLKTWFNQPARNGAPPGCSLLRSAEAQFPRPAAGLLRPIVRWRRP*STTPSSCI 258
           ++   + +KTWFNQPAR       +  + A   FPRP +G LRPIV+ +        S  
Sbjct: 14  KKHWQNYVKTWFNQPARKQRRR-IARQKKAVKIFPRPTSGPLRPIVQCQTL-KYNMKSRA 71

Query: 259 GKGFTL*RAEVSAGDPCAHGWPALGIAIDHRRRNKSLESLQAERSASEGLPQQPGRLPAQ 438
           G+GFTL   + +AG P  +  P +GI++DHRR+N+SLE LQA     +    +    P +
Sbjct: 72  GRGFTLEELK-AAGIPKKYA-PTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRR 129

Query: 439 CQEAEGFRDPSGRCANCGRPGQGRRGPAPGSRPRRRWRPSMVTSEMKATAGKELAEIKAT 618
            ++ +     +   A   +  QG   P      +R      VT EMKA            
Sbjct: 130 ARKVKAGDSTAEELATATQV-QGDYMPIARGE-KRSVEVVKVTDEMKAFK---------- 177

Query: 619 AYAKLRLERMNVRQVGPRAKKAKEAAKEE 705
           AYAKLR+ERMN R VG R K+A EA KEE
Sbjct: 178 AYAKLRVERMNQRHVGARQKRAAEAEKEE 206

 Score = 35.8 bits (81), Expect = 2.0
 Identities = 27/68 (39%), Positives = 30/68 (43%), Gaps = 1/68 (1%)
 Frame = +3

Query: 66  NNHFKKKWQFYVED-LVQPACSQWSAAGLLAAKKCRGSVPSPGRRPAAPHCSLAQTLKYN 242
           N HFKK WQ YV+    QPA  Q     +   KK     P P   P  P     QTLKYN
Sbjct: 10  NGHFKKHWQNYVKTWFNQPARKQ--RRRIARQKKAVKIFPRPTSGPLRPIVQ-CQTLKYN 66

Query: 243 TKQLHWQG 266
            K    +G
Sbjct: 67  MKSRAGRG 74

>dbj|BAA92738.1| ESTs AU077873(S1878),D40121(S1878) correspond to a region of the
           predicted gene.~Similar to Arabidopsis thaliana 60S
           ribosomal protein L13 (P41127) [Oryza sativa (japonica
           cultivar-group)] gi|24413953|dbj|BAC22205.1| putative
           60S ribosomal protein [Oryza sativa (japonica
           cultivar-group)]
          Length = 208

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 74/209 (35%), Positives = 103/209 (48%)
 Frame = +1

Query: 79  RRSGSSMLKTWFNQPARNGAPPGCSLLRSAEAQFPRPAAGLLRPIVRWRRP*STTPSSCI 258
           ++   + +KTWFNQPAR       +  + A   FPRP +G LRPIV+ +        S  
Sbjct: 14  KKHWQNYVKTWFNQPARKQRRR-IARQKKAVKIFPRPTSGPLRPIVQCQTL-KYNMKSRA 71

Query: 259 GKGFTL*RAEVSAGDPCAHGWPALGIAIDHRRRNKSLESLQAERSASEGLPQQPGRLPAQ 438
           G+GFTL   + +AG P     P +GI++DHRR+N+SLE LQA     +    +    P +
Sbjct: 72  GRGFTLEELK-AAGIPKKFA-PTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRR 129

Query: 439 CQEAEGFRDPSGRCANCGRPGQGRRGPAPGSRPRRRWRPSMVTSEMKATAGKELAEIKAT 618
            ++ +         A   +  QG   P      +R      VT +MKA            
Sbjct: 130 ARKVKAGDSTPEELATATQV-QGDYMPITRGE-KRSVEVVKVTDDMKAFK---------- 177

Query: 619 AYAKLRLERMNVRQVGPRAKKAKEAAKEE 705
           AYAKLR+ERMN R +G R K+A EA KEE
Sbjct: 178 AYAKLRVERMNQRHIGARQKRAAEAEKEE 206

 Score = 35.8 bits (81), Expect = 2.0
 Identities = 27/68 (39%), Positives = 30/68 (43%), Gaps = 1/68 (1%)
 Frame = +3

Query: 66  NNHFKKKWQFYVED-LVQPACSQWSAAGLLAAKKCRGSVPSPGRRPAAPHCSLAQTLKYN 242
           N HFKK WQ YV+    QPA  Q     +   KK     P P   P  P     QTLKYN
Sbjct: 10  NGHFKKHWQNYVKTWFNQPARKQ--RRRIARQKKAVKIFPRPTSGPLRPIVQ-CQTLKYN 66

Query: 243 TKQLHWQG 266
            K    +G
Sbjct: 67  MKSRAGRG 74

>sp|P49627|RL13_TOBAC 60S RIBOSOMAL PROTEIN L13 (CLONE 6.2.1) gi|1084420|pir||S50116
           ribosomal protein L13 - common tobacco
           gi|467325|gb|AAA72054.1| [Nicotiana tabacum (clone
           6.2.1) mRNA, complete cds.], gene product
          Length = 202

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 75/209 (35%), Positives = 98/209 (46%)
 Frame = +1

Query: 79  RRSGSSMLKTWFNQPARNGAPPGCSLLRSAEAQFPRPAAGLLRPIVRWRRP*STTPSSCI 258
           ++   + +KTWFNQPAR       +  + A    PRP AG LRPIV  +           
Sbjct: 9   KKHWQNYVKTWFNQPARK-TRRRIARQKKAVKISPRPTAGTLRPIVHGQTL-KYNMKVRS 66

Query: 259 GKGFTL*RAEVSAGDPCAHGWPALGIAIDHRRRNKSLESLQAERSASEGLPQQPGRLPAQ 438
           G+GF+L   + +AG P     P +GIA+DHRRRN+SLE LQ      E L  Q    P +
Sbjct: 67  GRGFSLEELK-AAGIPKKLA-PTIGIAVDHRRRNRSLEGLQTNVQRLEDLQGQLVVFPRR 124

Query: 439 CQEAEGFRDPSGRCANCGRPGQGRRGPAPGSRPRRRWRPSMVTSEMKATAGKELAEIKAT 618
              +     P     NC    Q      P  R + +   S V  +MK+            
Sbjct: 125 ASRSRLVILPP---RNCLTATQVHGAYMPIEREKHQLILSKVLKKMKSF----------N 171

Query: 619 AYAKLRLERMNVRQVGPRAKKAKEAAKEE 705
           AYAKLR+ER N R +G R K+A EA KEE
Sbjct: 172 AYAKLRVERTNERHIGARMKRAAEAEKEE 200



EST assemble image


clone accession position
1 CM099b04_r AV393107 1 636
2 LC069h08_r AV623876 9 729
3 LC068a09_r AV623741 11 672
4 HC068f06_r AV637097 13 487
5 HC004g09_r AV632169 16 703
6 MX228e11_r BP090751 38 481
7 HC074a03_r AV637509 38 646
8 HC009a04_r AV632499 39 602
9 CM014f08_r AV387405 100 773
10 CM042a09_r AV389276 101 325
11 CM084g03_r AV392602 101 503
12 CM063h01_r AV390066 101 647
13 CM056h01_r AV390291 101 666
14 CM008e05_r AV386716 101 720
15 CM029e12_r AV389379 101 793
16 CM087e08_r AV392473 101 725
17 CM029d01_r AV389322 101 767
18 CM100b09_r AV392800 101 542
19 CM030f11_r AV397376 101 785
20 CM054g01_r AV389988 101 509
21 CM077d12_r AV391796 101 804
22 CM076g09_r AV391686 101 784
23 CM043g02_r AV389509 101 434
24 CM050a07_r AV389760 101 427
25 CM076f09_r AV391685 101 740
26 CM016g05_r AV387448 101 737
27 CM037g10_r AV388877 102 633
28 LC024c04_r AV620604 103 466
29 CM067e10_r AV390899 103 773
30 HCL022e05_r AV640791 103 576
31 LC005h07_r AV619267 103 729
32 HC044h02_r AV635320 103 486
33 LCL050h07_r AV629047 104 459
34 HC071a05_r AV637277 104 628
35 LCL097b05_r AV631622 104 458
36 LC007b12_r AV619360 104 730
37 LC007h02_r AV619399 105 619
38 LCL001c02_r AV626026 106 655
39 CM093b11_r AV392973 106 704
40 MXL002f06_r BP093049 106 600
41 LCL073b07_r AV630103 106 612
42 LC013a06_r AV619775 106 677
43 CM058c09_r AV390401 107 755
44 CM076c12_r AV391718 107 750
45 MX035h07_r BP087506 108 524
46 HC030b07_r AV634174 108 679
47 HC029h08_r AV634154 108 703
48 CM037e12_r AV388909 108 702
49 HC011h02_r AV632725 108 630
50 HC088e01_r AV638606 108 703
51 HC012a02_r AV632737 108 669
52 MX065b10_r BP088623 108 518
53 HC077c04_r AV637767 108 612
54 HC083f03_r AV638232 108 681
55 HC048f04_r AV635618 108 681
56 HC059b10_r AV636416 108 627
57 CM010f07_r AV387008 108 548
58 HC061b02_r AV636559 108 552
59 HC043e07_r AV635222 108 572
60 CM028c08_r AV387734 108 759
61 MX051b09_r BP088087 108 598
62 HCL090d06_r AV644550 108 591
63 HC040g12_r AV635014 108 589
64 MX103e04_r BP088988 109 644
65 HC018c12_r AV633232 109 654
66 HCL080f11_r AV644037 109 673
67 HC091h01_r AV638866 109 374
68 HC001g01_r AV631920 109 606
69 HC001e10_r AV631906 109 605
70 MX103c06_r BP088969 109 462
71 HC049e05_r AV635682 109 672
72 HC031e07_r AV634292 109 701
73 LC021c04_r AV620371 109 706
74 MX104e06_r BP089075 109 624
75 MX101g03_r BP088843 109 661
76 MX039d06_r BP087622 109 613
77 CM092g01_r AV392659 109 663
78 LC056b10_r AV622893 109 669
79 CM082d12_r AV392101 109 572
80 HCL063g02_r AV643098 110 625
81 LC023a05_r AV643098 110 457
82 HC022c09_r AV633562 110 667
83 CM028a11_r AV387711 110 745
84 HC018b11_r AV633219 110 669
85 HC056h01_r AV636236 110 606
86 HC067a08_r AV636984 111 556
87 HC032c03_r AV634347 112 371
88 HCL055c06_r AV642644 112 680
89 LCL064f03_r AV629723 112 521
90 LC079b06_r AV624539 113 646
91 HCL074g10_r AV643722 114 514
92 LC038g03_r AV621630 114 652
93 MX064a11_r BP088577 114 562
94 HC061g07_r AV636610 114 696
95 CL43h10_r AV395552 114 659
96 LC043h10_r AV622086 114 653
97 HCL038e10_r AV641678 114 617
98 MX038f11_r BP087604 114 537
99 CL72d09_r AV397007 114 681
100 CM006b12_r AV387198 115 737
101 LC076c03_r AV624330 116 246
102 CM035h09_r AV388716 116 687
103 HC077c07_r AV637770 116 691
104 LC028c02_r AV620891 116 726
105 HC014b08_r AV632905 118 668
106 HC013e11_r AV632857 118 556
107 LCL096g08_r AV631601 118 514
108 HC032h05_r AV634400 118 677
109 HC063c04_r AV636712 118 631
110 LC075a08_r AV624247 118 644
111 HC091b01_r AV638809 118 649
112 CM011d03_r AV386892 118 441
113 CM045f05_r AV389692 118 544
114 HCL015f04_r AV640399 118 413
115 CM065f01_r AV391162 119 811
116 CM008f09_r AV386731 119 735
117 CM018h02_r AV387280 119 783
118 CM021f05_r AV387970 119 765
119 LC013c07_r AV619795 119 730
120 HC098c11_r AV639355 123 655
121 HC085c09_r AV638352 124 688
122 HC075h11_r AV637663 124 634
123 HC100a05_r AV639489 124 575
124 HC038f05_r AV634838 124 732
125 HC089c05_r AV638671 124 580
126 CM025g02_r AV388113 125 794
127 HC003e12_r AV632074 127 458
128 CM049e05_r AV389649 127 425
129 HC060e03_r AV636512 127 632
130 HCL028a06_r AV641117 127 612
131 MXL085e06_r BP098025 127 661
132 HC099d07_r AV639440 128 594
133 CM033d12_r AV388428 129 725
134 HC049f07_r AV388428 129 750
135 HC040b02_r AV634956 137 575
136 CM042a05_r AV389268 140 417
137 LC059g04_r AV623160 150 701
138 MX063d06_r BP088560 152 550
139 HC063b07_r AV636705 154 680
140 HC095f09_r AV639155 155 662
141 LC029c11_r AV620966 159 763
142 HC006f08_r AV632315 173 605
143 LCL011h10_r AV626587 175 344
144 HC061c09_r AV636573 179 580
145 CM087a11_r AV392461 191 815
146 CM018h11_r AV387232 191 788
147 HC067c03_r AV636999 197 625
148 CM016d10_r AV387452 216 869
149 MX202f06_r BP089196 236 715
150 MX065c01_r BP088626 267 724
151 LC036g05_r AV621482 292 729
152 MX056h12_r BP088308 295 668
153 MX258g01_r BP092758 320 718
154 HC092h10_r AV638943 321 458
155 MXL008b01_r BP093415 323 821
156 HC004g07_r AV632167 325 883
157 HC037a02_r AV634720 402 924
158 CM052f10_r AV390519 406 997
159 HC070c03_r AV637213 412 884
160 MX023b05_r BP087026 421 913
161 CM024a08_r AV388293 421 1055
162 MX035b07_r BP087466 469 977
163 CM045h09_r AV389698 493 1070
164 CM066c07_r AV390828 525 1053
165 CM021e06_r AV387964 529 1015
166 HCL073c03_r AV643640 530 1014
167 HC080c07_r AV637985 546 1001
168 CM016c12_r AV387501 547 1164
169 CM036h06_r AV388828 547 876
170 MX014a11_r BP086671 547 1029
171 CM047d09_r AV388583 547 725
172 CM002d02_r AV397841 554 721
173 LC062c04_r AV623335 597 1052
174 LCL025f07_r AV627364 608 1122
175 CM035a03_r AV388685 618 1135
176 CM057d09_r AV390477 620 1104
177 CL47c02_r AV395674 631 1149
178 CM096b11_r AV392751 730 1062
179 MXL019g04_r BP094221 866 1294
180 MX003c01_r BP086168 930 1336
181 MXL018d06_r BP094118 978 1313
182 CM060c02_r AV390793 1016 1609
183 CL09b04_r AV393726 1083 1624
184 CL66b02_r AV396723 1095 1624
185 HC079f05_r AV637938 1108 1268
186 CL21b12_r AV394351 1140 1623
187 CL74b12_r AV396497 1144 1582
188 HC098h08_r AV639404 1183 1624
189 HCL010g05_r AV640121 1185 1507
190 CL13c08_r AV393935 1218 1624
191 HC021d02_r AV633484 1278 1696
192 HCL095b02_r AV644885 1380 1624




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research