KCC000185A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000185A_C01 KCC000185A_c01
taggccgctagctcaaaaaaatggccgtgggtgttaagAAGCCGGCCGCCAAGGGCGCGG
CGAAGAAGAAGGCCCTGGTCTTCACCATCGACTGCTCCAAGCCGGTGGAGGACAAGATTA
TGGACATCTCCTCGTTTGAGAAGTTCCTGATGGACAAGATCAAGGTGGACGGCAAGACCG
GCGTGCTGGGCGACTCTATCAAGGTGGCCAAGGAGAAGACCAAGGTCACCGTGACTGCTG
AGTCCCAGCTGAGCAAGCGCTACCTGAAGTACCTCACCAAGAAGTACCTGAAGAAGCACA
ACGTGCGCGACTGGCTGCGCGTCATTGCTTCCAACAAGGACCGCAACGTCTACGAGCTCC
GGTACTTCAACATTGCCGACAACGAGGCTGAGGACGAGGAGTAAGCGGCCTGTAGCAAGC
TGGAGTGGAGCTCTGGGCGTGGAACTGGCGGCCGCCGCATGCGATGCAGCTGAGTTGGCG
GCTGGAGCTATGCGGCGAACGTTCAGTTCGCGCGTTTTGGACGGGCGTGCTGGCGCTGTG
GAGCGTGTGCGGCCGGTGCAGCCGGGTGGTGAAGGGATTGTAACGAGAGAAATGTCCAc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000185A_C01 KCC000185A_c01
         (599 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_198129.1| 60S ribosomal protein L22 (RPL22C) [Arabidopsis...   187  1e-46
ref|NP_187207.1| putative 60S ribosomal protein  L22 [Arabidopsi...   185  5e-46
dbj|BAC83533.1| putative 60S ribosomal protein L22 [Oryza sativa...   177  1e-43
ref|NP_171782.1| 60S ribosomal protein L22 (RPL22A) [Arabidopsis...   154  7e-37
dbj|BAB21247.1| ribosomal protein L22 [Gallus gallus]                 149  3e-35

>ref|NP_198129.1| 60S ribosomal protein L22 (RPL22C) [Arabidopsis thaliana]
           gi|17865557|sp|Q9FE58|R22C_ARATH 60S ribosomal protein
           L22-3 gi|11692938|gb|AAG40072.1|AF324721_1 T1G16
           [Arabidopsis thaliana]
           gi|11908022|gb|AAG41440.1|AF326858_1 putative 60S
           ribosomal protein L22 [Arabidopsis thaliana]
           gi|12642842|gb|AAK00363.1|AF339681_1 putative 60S
           ribosomal protein L22 [Arabidopsis thaliana]
           gi|21554057|gb|AAM63138.1| 60S ribosomal protein
           L22-like [Arabidopsis thaliana]
           gi|27808502|gb|AAO24531.1| At5g27770 [Arabidopsis
           thaliana]
          Length = 124

 Score =  187 bits (475), Expect = 1e-46
 Identities = 89/119 (74%), Positives = 106/119 (88%)
 Frame = +3

Query: 45  AAKGAAKKKALVFTIDCSKPVEDKIMDISSFEKFLMDKIKVDGKTGVLGDSIKVAKEKTK 224
           AAKG  KKK + FTIDCSKPV+DKIM+I+S EKFL ++IKV GK G LGDS+ + +EK+K
Sbjct: 8   AAKG--KKKGVSFTIDCSKPVDDKIMEIASLEKFLQERIKVGGKAGALGDSVSITREKSK 65

Query: 225 VTVTAESQLSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIADNEAEDEE 401
           +TVTA+ Q SKRYLKYLTKKYLKKHNVRDWLRVIA+NKDRN+YELRYFNIA+NEAE+E+
Sbjct: 66  ITVTADGQFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNLYELRYFNIAENEAEEED 124

>ref|NP_187207.1| putative 60S ribosomal protein  L22 [Arabidopsis thaliana]
           gi|17865568|sp|Q9M9W1|R22B_ARATH 60S ribosomal protein
           L22-2 gi|6714454|gb|AAF26141.1|AC011620_17 putative 60S
           ribosomal protein  L22 [Arabidopsis thaliana]
           gi|17529148|gb|AAL38800.1| putative 60S ribosomal
           protein L22 [Arabidopsis thaliana]
           gi|20466019|gb|AAM20231.1| putative 60S ribosomal
           protein L22 [Arabidopsis thaliana]
           gi|21595684|gb|AAM66123.1| 60S ribosomal protein L22-2
           [Arabidopsis thaliana] gi|27311727|gb|AAO00829.1|
           putative 60S ribosomal protein  L22 [Arabidopsis
           thaliana] gi|30102826|gb|AAP21331.1| At3g05560
           [Arabidopsis thaliana]
          Length = 124

 Score =  185 bits (469), Expect = 5e-46
 Identities = 86/119 (72%), Positives = 103/119 (86%)
 Frame = +3

Query: 45  AAKGAAKKKALVFTIDCSKPVEDKIMDISSFEKFLMDKIKVDGKTGVLGDSIKVAKEKTK 224
           AA    KKK + FTIDCSKPV+DKIM+I+S EKFL ++IKV GK G LGDS+ + +EK+K
Sbjct: 6   AAVAKGKKKGVSFTIDCSKPVDDKIMEIASLEKFLQERIKVGGKAGALGDSVTITREKSK 65

Query: 225 VTVTAESQLSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIADNEAEDEE 401
           +TVTA+ Q SKRYLKYLTKKYLKKHNVRDWLRVIA+NKDRN+YELRYFNIA+NE E+E+
Sbjct: 66  ITVTADGQFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNLYELRYFNIAENEGEEED 124

>dbj|BAC83533.1| putative 60S ribosomal protein L22 [Oryza sativa (japonica
           cultivar-group)] gi|34395084|dbj|BAC84770.1| putative
           60S ribosomal protein L22 [Oryza sativa (japonica
           cultivar-group)]
          Length = 130

 Score =  177 bits (448), Expect = 1e-43
 Identities = 91/130 (70%), Positives = 106/130 (81%), Gaps = 3/130 (2%)
 Frame = +3

Query: 21  MAVGVKKPAAKGAAKKK--ALVFTIDCSKPVEDKIMDISSFEKFLMDKIKV-DGKTGVLG 191
           MA GV   A  GA  KK  ++ F IDCSKPVEDKIM+I+S EKFL ++IKV  GK G LG
Sbjct: 1   MARGVAVAAKGGAGGKKKGSVSFVIDCSKPVEDKIMEIASLEKFLQERIKVAGGKAGNLG 60

Query: 192 DSIKVAKEKTKVTVTAESQLSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFN 371
           DS+ V ++KTKVTVT++   SKRYLKYLTKKYLKKHNVRDWLRVIA+NKDRNVYELRYFN
Sbjct: 61  DSVTVTRDKTKVTVTSDGAFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNVYELRYFN 120

Query: 372 IADNEAEDEE 401
           IA+NE E+E+
Sbjct: 121 IAENEGEEED 130

>ref|NP_171782.1| 60S ribosomal protein L22 (RPL22A) [Arabidopsis thaliana]
           gi|17865572|sp|Q9SRX7|R22A_ARATH 60S ribosomal protein
           L22-1 gi|25295576|pir||E86158 60S ribosomal protein L22
           [imported] - Arabidopsis thaliana
           gi|6056419|gb|AAF02883.1|AC009525_17 60S ribosomal
           protein  L22 [Arabidopsis thaliana]
          Length = 127

 Score =  154 bits (390), Expect = 7e-37
 Identities = 76/125 (60%), Positives = 93/125 (73%)
 Frame = +3

Query: 27  VGVKKPAAKGAAKKKALVFTIDCSKPVEDKIMDISSFEKFLMDKIKVDGKTGVLGDSIKV 206
           VG K   A   AKKK + F IDCSKPV+D I++I++ EKFL ++IKV GK G LG+S+ +
Sbjct: 4   VGAKSSGA--GAKKKGVSFVIDCSKPVDDTILEIATLEKFLQERIKVRGKAGALGNSVSI 61

Query: 207 AKEKTKVTVTAESQLSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIADNE 386
            +   K+ V A S  SKRYLKYLTKKYLKK+N+RDWLRVIASNKD+NVYE+RYF I D  
Sbjct: 62  TRYNGKINVNANSNFSKRYLKYLTKKYLKKYNLRDWLRVIASNKDKNVYEVRYFRIDDEV 121

Query: 387 AEDEE 401
           A  EE
Sbjct: 122 ASYEE 126

>dbj|BAB21247.1| ribosomal protein L22 [Gallus gallus]
          Length = 128

 Score =  149 bits (376), Expect = 3e-35
 Identities = 76/125 (60%), Positives = 98/125 (77%), Gaps = 2/125 (1%)
 Frame = +3

Query: 33  VKKPAAKGAAKKK-ALVFTIDCSKPVEDKIMDISSFEKFLMDKIKVDGKTGVLGDSI-KV 206
           VKKPAAKG  KKK  L FT+DC+ PVED IMD ++FE+FL ++IKV+GK G LG  +  +
Sbjct: 4   VKKPAAKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTI 63

Query: 207 AKEKTKVTVTAESQLSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIADNE 386
            + K+K+TVT+E   SKRYLKYLTKKYLKK+N+RDWLRV+A++K+   YELRYF I  +E
Sbjct: 64  ERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKES--YELRYFQINQDE 121

Query: 387 AEDEE 401
            E+EE
Sbjct: 122 EEEEE 126



EST assemble image


clone accession position
1 CL75h03_r AV397042 1 602
2 LC037c03_r AV621522 5 537
3 LC082h10_r AV624799 6 506
4 CL23h01_r AV394504 10 552
5 LC012h03_r AV619765 10 556
6 CL09b08_r AV393729 10 601
7 HC032h09_r AV634402 12 550
8 HC025g07_r AV633828 12 515
9 CL20a02_r AV394293 12 550
10 MXL097e10_r BP098696 15 370
11 CM027f11_r AV387661 15 624
12 CM032h03_r AV388462 18 394
13 MXL075h08_r BP097449 18 382
14 HCL012e03_r AV640224 21 149
15 CL28c04_r AV394816 24 547
16 HCL039g06_r AV641752 25 547
17 CM004d08_r AV386667 38 577
18 CM012d10_r AV387110 43 602
19 CL23g03_r AV394477 47 578
20 CL62a12_r AV396444 52 586
21 CL77d02_r AV397264 88 604
22 CL09a10_r AV393720 102 563
23 CM062f12_r AV390115 222 701




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research