KCC000184A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000184A_C02 KCC000184A_c02
cccaaagtctaaAAAACCAGGTATACTGTATGCTTTAGGTTCTTGCGCAACCTGACGAGT
CAGGCAGACTCCTGTCCTTGCTTTATCAAAAACACGCACTGTACATAGTTATACACGAAG
ACTGATTTGATTTTATCGTAAGCACGCTTGGGCGCAAGCTGAGGTCAGGTTCGCTCACAA
GGCAGGCAAGCTTTCCGTTCATCCTGGAGCTAACAGGAGAGCTGTGGAGAGAAATGGGCA
CAATGACCTGAGACTGGCCCGAGCGCAAAATGGACTCGGAGCAGCAGCCGGCCAGCCCGA
GGGCTGCGCCTGGTGCAAGCGGAGGCCGACGCTTGCCTGGTCGGACACCTTCTGGTCTAT
TGGGACAGGCAGCGCAGGGGCCGCAGCAACCTCAGCCCCAACTTGGCAAGGGAGCACTTC
AGCTCAATCAGTCCAGCAGCGCAGCGACAACCGCGTTGCCGGTGAAACGTCGGGGGAGTT
TCCAGCAGTTGAAGAAAATAGGTGCCGCCGGGGGGCGAGATGGCAGCTCTTCGCACCTGG
ACTCGGACTCGGCACCATCAATTTTCGCCATTGTGAAAAAGTCCACACACTGGGAAAAGT
ATGGCACGGTGCTCGTGCTGCTCGTTGCCGACGAGCTCAGCAGTGACAAGGAGGCGGTGG
TGCAGATGCTGAGCGCAGAGGGATACGATGACCAGACGTCGGACAGCATCGAGGAGGCGG
TGAAGTTGTTTTCGGAAAGGGAGGTGTACCCGGACATTGTTATTGTTGATTCAGACAATG
AGCTGGTGGACACCAAACAGCTCATCAAGGCGCTGCAGGCGCTGAACCCCACGGTGGCGG
TGCTGGTACTGGGCAGCCGCGGCGGGCCCATGGGCGCGGTGGCGGCGCTGCAGGCGGGCG
CGGTGGACTACATGGTGAAGCCGCTGGATCTGGATGAGGTGGTTGCCCGCGTGGAGCGAC
ACGTGCAGCGACAGCAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000184A_C02 KCC000184A_c02
         (977 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC55695.1| putative diaphanous homologue [Oryza sativa (jap...    67  6e-10
ref|NP_302402.1| two-component response regulator [Mycobacterium...    65  1e-09
gb|AAL27375.1|AF426171_6 HydG [Yersinia pestis]                        64  3e-09
sp|Q10531|PRRA_MYCTU Transcriptional regulatory protein prrA           64  3e-09
ref|NP_215418.1| hypothetical protein Rv0903c [Mycobacterium tub...    64  3e-09

>dbj|BAC55695.1| putative diaphanous homologue [Oryza sativa (japonica
            cultivar-group)]
          Length = 1627

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 47/110 (42%), Positives = 50/110 (44%), Gaps = 10/110 (9%)
 Frame = -3

Query: 948  GQPPHPDPAASPCSPPRPPAA------PPPRPWARRGCPVPAPPPWG--SAPAAP**AVW 793
            G PP P P  SP  PP PP A      PPP P AR G P P PPP G  SAP  P     
Sbjct: 1041 GAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLP----- 1095

Query: 792  CPPAHCLNQQ*QCPGTPPFPKTT--SPPPRCCPTSGHRIPLRSASAPPPP 649
             PP      +   P  PP P T   +PPP   P +G R P      PPPP
Sbjct: 1096 -PP----GGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAP------PPPP 1134

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 38/116 (32%), Positives = 45/116 (38%), Gaps = 14/116 (12%)
 Frame = -3

Query: 954  PRGQPPHPDPAASPC-SPPRPPAAPPPRPWARRGCPVPAPPP-------------WGSAP 817
            P   PP P  +  P  SPP PP  PP +P +   CP P PPP             + SAP
Sbjct: 916  PPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAP 975

Query: 816  AAP**AVWCPPAHCLNQQ*QCPGTPPFPKTTSPPPRCCPTSGHRIPLRSASAPPPP 649
              P      PP   L      P  PP   + +PPP   P +    P      PPPP
Sbjct: 976  PPP------PPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAP------PPPP 1019

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 36/102 (35%), Positives = 44/102 (42%), Gaps = 4/102 (3%)
 Frame = -3

Query: 942  PPHPDP----AASPCSPPRPPAAPPPRPWARRGCPVPAPPPWGSAPAAP**AVWCPPAHC 775
            PP P P     A P  PP P   PPP P   R  P P PPP G+ P  P      PP   
Sbjct: 1031 PPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPP-----PPPPPP 1085

Query: 774  LNQQ*QCPGTPPFPKTTSPPPRCCPTSGHRIPLRSASAPPPP 649
              +    P  PP  + ++PPP   P++      R  + PPPP
Sbjct: 1086 GGRPSAPPLPPPGGRASAPPPPPPPST------RLGAPPPPP 1121

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 41/113 (36%), Positives = 45/113 (39%), Gaps = 7/113 (6%)
 Frame = -3

Query: 966  ARVAPRGQPPHPDPAASPCSPPRP----PAAPP-PRPWARRGCPVPAPPPWGSAPAAP** 802
            AR  P   PP P     P  PP P    P+APP P P  R   P P PPP  +   AP  
Sbjct: 1061 ARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPP-STRLGAP-- 1117

Query: 801  AVWCPPAHCLNQQ*QCPGTPPFP--KTTSPPPRCCPTSGHRIPLRSASAPPPP 649
                PP        + P  PP P  +   PPP   P      P R   APPPP
Sbjct: 1118 ----PPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPP 1166

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 43/118 (36%), Positives = 47/118 (39%), Gaps = 20/118 (16%)
 Frame = -3

Query: 942  PPHPDPAA---SPCSPPRPPAA-------PPPRPWARRGCPV---------PAPPPWGSA 820
            PP P PAA   +P  PP PP         PPP P  R G P          P PPP G+ 
Sbjct: 1003 PPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGAR 1062

Query: 819  PAAP**AVWCPPAHCLNQQ*QCPGTPPFPKTTSPPPRCCPTSGHRIPLRS-ASAPPPP 649
            P  P      PP          PG  P P    PPP   P++    P    ASAPPPP
Sbjct: 1063 PGPP------PPP-------PPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPP 1107

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 38/113 (33%), Positives = 43/113 (37%), Gaps = 10/113 (8%)
 Frame = -3

Query: 957  APRGQPPHPDPAASPCSPPRPPAA------PPPRPWARRGCPVPAPPP----WGSAPAAP 808
            AP   PP P   + P  PP PP +      PPP P AR   P P PPP    + + P  P
Sbjct: 974  APPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPP 1033

Query: 807  **AVWCPPAHCLNQQ*QCPGTPPFPKTTSPPPRCCPTSGHRIPLRSASAPPPP 649
                  PP    +     P  PP P    PPP   P      P   A   PPP
Sbjct: 1034 ------PPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPP 1080

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 37/112 (33%), Positives = 44/112 (39%), Gaps = 14/112 (12%)
 Frame = -3

Query: 942  PPHPDPAASPCS------PPRPPAAPPP------RPWARRGCPVPAPPPWGSAPAAP**A 799
            PP P P   P S      PP PP  PPP      R ++    P P PP   S P  P   
Sbjct: 935  PPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPP--- 991

Query: 798  VWCPPAHCLNQQ*QCPGTPPFP--KTTSPPPRCCPTSGHRIPLRSASAPPPP 649
               PP    +     P  PP P  +  +PPP   P + H       +APPPP
Sbjct: 992  ---PPPPISHS--NAPPPPPLPAARFNAPPPPPPPPTTH------FNAPPPP 1032

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 48/166 (28%), Positives = 57/166 (33%), Gaps = 4/166 (2%)
 Frame = -3

Query: 957  APRGQPPHPDPAASPCSPPRPPAAPPPRPWARRGCPVPAPPPWGSAPAAP**AVWCPPAH 778
            A + QPP P P      PP PP  PPP        P P PPP   +  A       PP  
Sbjct: 848  ATKQQPPPPPPP-----PPLPPPPPPPASSGLSSIPPPPPPPPLMSFGAQTRTFVPPP-- 900

Query: 777  CLNQQ*QCPGTPPFPKT----TSPPPRCCPTSGHRIPLRSASAPPPPCHC*ARRQRAARA 610
                    P  PP P++     +PP    P     +P  S   PPPP       + ++ A
Sbjct: 901  --------PPPPPPPRSGVGGNTPPAPPPPPLRSTVPAISPPPPPPP----PPLKPSSGA 948

Query: 609  PCHTFPSVWTFSQWRKLMVPSPSPGAKSCHLAPRRHLFSSTAGNSP 472
            PC   P             P P P   S   AP    FSS     P
Sbjct: 949  PCPPPPP------------PPPPPPPPS---APSSRAFSSAPPPPP 979

 Score = 42.7 bits (99), Expect = 0.009
 Identities = 42/148 (28%), Positives = 52/148 (34%)
 Frame = -3

Query: 903  PRPPAAPPPRPWARRGCPVPAPPPWGSAPAAP**AVWCPPAHCLNQQ*QCPGTPPFPKTT 724
            P+  AAPPP        P P PPP+ S+ +           H  +   Q P  PP P   
Sbjct: 819  PKIQAAPPP--------PPPPPPPYASSSSL--------SMHMGSATKQQPPPPPPPPPL 862

Query: 723  SPPPRCCPTSGHRIPLRSASAPPPPCHC*ARRQRAARAPCHTFPSVWTFSQWRKLMVPSP 544
             PPP    +SG    L S   PPPP                  P + +F    +  VP P
Sbjct: 863  PPPPPPPASSG----LSSIPPPPPP------------------PPLMSFGAQTRTFVPPP 900

Query: 543  SPGAKSCHLAPRRHLFSSTAGNSPDVSP 460
             P        PR    S   GN+P   P
Sbjct: 901  PPPPP----PPR----SGVGGNTPPAPP 920

>ref|NP_302402.1| two-component response regulator [Mycobacterium leprae]
           gi|34098418|sp|Q50136|PRRA_MYCLE Transcriptional
           regulatory protein prrA gi|11278068|pir||T45359
           two-component regulator [imported] - Mycobacterium
           leprae gi|2440114|emb|CAB16701.1| two-component
           regulator [Mycobacterium leprae]
           gi|13093693|emb|CAC31078.1| two-component response
           regulator [Mycobacterium leprae]
          Length = 233

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 41/119 (34%), Positives = 70/119 (58%)
 Frame = +3

Query: 618 LLVADELSSDKEAVVQMLSAEGYDDQTSDSIEEAVKLFSEREVYPDIVIVDSDNELVDTK 797
           +LV D+ S    ++ + L   G++   S +I+ A  L +  E  PD +++D +  ++D  
Sbjct: 10  VLVVDDDSDVLASLERGLRLSGFE--VSTAIDGAEALRNATETRPDAIVLDINMPVLDGV 67

Query: 798 QLIKALQALNPTVAVLVLGSRGGPMGAVAALQAGAVDYMVKPLDLDEVVARVERHVQRQ 974
            ++ AL+A++  V V VL +R      VA L+AGA DY+VKP  L E+VARV+  ++R+
Sbjct: 68  SVVTALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRR 126

>gb|AAL27375.1|AF426171_6 HydG [Yersinia pestis]
          Length = 463

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 35/120 (29%), Positives = 66/120 (54%)
 Frame = +3

Query: 618 LLVADELSSDKEAVVQMLSAEGYDDQTSDSIEEAVKLFSEREVYPDIVIVDSDNELVDTK 797
           +LV D+  S    +  ++   GY    + +  EA++L   +E+  D+++ D     +D  
Sbjct: 17  ILVVDDDLSHCTIIQALMKGWGYQTTPAHNGLEAIEL--AKEIPFDLILTDVRMSEMDGI 74

Query: 798 QLIKALQALNPTVAVLVLGSRGGPMGAVAALQAGAVDYMVKPLDLDEVVARVERHVQRQH 977
           + +KA++A NP + +L++ +      AV A++AGA DY+ KPLD D +   +ER ++  H
Sbjct: 75  EALKAIKAYNPAIPILIMTAYSNVESAVEAIKAGAYDYLTKPLDFDMLQLTLERALEHTH 134

>sp|Q10531|PRRA_MYCTU Transcriptional regulatory protein prrA
          Length = 233

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 41/119 (34%), Positives = 70/119 (58%)
 Frame = +3

Query: 618 LLVADELSSDKEAVVQMLSAEGYDDQTSDSIEEAVKLFSEREVYPDIVIVDSDNELVDTK 797
           +LV D+ S    ++ + L   G++  T+  ++ A  L S  E  PD +++D +  ++D  
Sbjct: 10  VLVVDDDSDVLASLERGLRLSGFEVATA--VDGAEALRSATENRPDAIVLDINMPVLDGV 67

Query: 798 QLIKALQALNPTVAVLVLGSRGGPMGAVAALQAGAVDYMVKPLDLDEVVARVERHVQRQ 974
            ++ AL+A++  V V VL +R      VA L+AGA DY+VKP  L E+VARV+  ++R+
Sbjct: 68  SVVTALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRR 126

>ref|NP_215418.1| hypothetical protein Rv0903c [Mycobacterium tuberculosis H37Rv]
           gi|15840322|ref|NP_335359.1| DNA-binding response
           regulator [Mycobacterium tuberculosis CDC1551]
           gi|31792091|ref|NP_854584.1| TWO COMPONENT RESPONSE
           TRANSCRIPTIONAL REGULATORY PROTEIN PRRA [Mycobacterium
           bovis subsp. bovis AF2122/97] gi|7444066|pir||D70783
           probable two component system regulatory protein -
           Mycobacterium tuberculosis (strain H37RV)
           gi|1314043|emb|CAA97378.1| hypothetical protein Rv0903c
           [Mycobacterium tuberculosis H37Rv]
           gi|13880485|gb|AAK45173.1| DNA-binding response
           regulator [Mycobacterium tuberculosis CDC1551]
           gi|31617679|emb|CAD93788.1| TWO COMPONENT RESPONSE
           TRANSCRIPTIONAL REGULATORY PROTEIN PRRA [Mycobacterium
           bovis subsp. bovis AF2122/97]
          Length = 236

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 41/119 (34%), Positives = 70/119 (58%)
 Frame = +3

Query: 618 LLVADELSSDKEAVVQMLSAEGYDDQTSDSIEEAVKLFSEREVYPDIVIVDSDNELVDTK 797
           +LV D+ S    ++ + L   G++  T+  ++ A  L S  E  PD +++D +  ++D  
Sbjct: 13  VLVVDDDSDVLASLERGLRLSGFEVATA--VDGAEALRSATENRPDAIVLDINMPVLDGV 70

Query: 798 QLIKALQALNPTVAVLVLGSRGGPMGAVAALQAGAVDYMVKPLDLDEVVARVERHVQRQ 974
            ++ AL+A++  V V VL +R      VA L+AGA DY+VKP  L E+VARV+  ++R+
Sbjct: 71  SVVTALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRR 129



EST assemble image


clone accession position
1 MXL057b07_r BP096346 1 385
2 LCL082e08_r AV630675 13 330
3 MXL035c08_r BP095069 14 284
4 MXL042f11_r BP095494 14 403
5 HCL014a02_r AV640307 38 529
6 CL08h12_r AV393542 129 647
7 HCL029e12_r AV641195 130 591
8 CL67d08_r AV396694 446 932
9 HCL033b12_r AV641414 452 978




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research