KCC000182A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000182A_C01 KCC000182A_c01
gTTGACGGCGTGTGGGTGACGCTGACGGAGCGGTAGCCGGCGGCGGCGGTGGTGTCCTGA
GGCAAGGCAGCATGGCACGACACTGTCGCTGCGTGCCGGGCGGCAGGGACTGGGATGTGT
TGTACCGTTGTACGGGCAGGAGCAGAGGTTGGCAGGGGGCCTGCACAGAGACGGCGCTGG
GCAGGTGGCATGCGCGCATGGGCTCAAGCGCTACTGCGGGGGGAGGTGCCGGGAAGACCC
ACACGATGGCATGTGCGAGCGCAGCACCATGGGAGCATCATGCCGCCGTACGCCAATGGA
TTCGTGGAAGCATTTTGTGGTGTTGCAAGAGTATGCACCGAAAGTTACATTGTAACGCAC
AAATGCTTTGCACACAACGGGGTTAGCGACGATCGACCAGCAGCACCGATGTGGAATGTC
GCCGAGTTGGGGTTGGCCCTCGTGCCCGTGGTAGTGCTGGCTTCTGTGCTGGTGAGCGAG
CCCGCATCCAGCCGCGCACCAATCTCAT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000182A_C01 KCC000182A_c01
         (508 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_147602.1| RIKEN cDNA 1110054P19 [Mus musculus] gi|2851434...    44  9e-04
ref|NP_083889.1| RIKEN cDNA 2310037K05 [Mus musculus] gi|1284460...    44  9e-04
emb|CAC27578.1| keratin associated protein 4.7 [Homo sapiens]          42  0.006
ref|XP_210345.2| similar to keratin associated protein 4-12; ker...    41  0.010
emb|CAC27580.1| keratin associated protein 4.9 [Homo sapiens]          40  0.013

>ref|XP_147602.1| RIKEN cDNA 1110054P19 [Mus musculus] gi|28514347|ref|XP_286394.1|
           RIKEN cDNA 1110054P19 [Mus musculus]
          Length = 195

 Score = 44.3 bits (103), Expect = 9e-04
 Identities = 32/117 (27%), Positives = 42/117 (35%)
 Frame = -2

Query: 408 RCCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSHMPSCGSSR 229
           +CC S+   P  C+     +       C  T C            P   R   PSC  S 
Sbjct: 48  QCCQSLCCQPTCCRPSCCISSCCRPTCCRPTCCISSCC------RPTCCR---PSCCISS 98

Query: 228 HLPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPCCLAS 58
              P      C  ++C  PS CRP   + SC       PS CRP+       CC++S
Sbjct: 99  CCRPTCCRPSCCISSCCRPSCCRPSCCISSCCRPSCCRPSCCRPS-------CCISS 148

 Score = 38.9 bits (89), Expect = 0.037
 Identities = 32/118 (27%), Positives = 40/118 (33%), Gaps = 2/118 (1%)
 Frame = -2

Query: 405 CCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSH--MPSCGSS 232
           CC S    P  C+       T    SC    C   S  +     P   R    + SC   
Sbjct: 64  CCISSCCRPTCCRP------TCCISSCCRPTCCRPSCCISSCCRPTCCRPSCCISSCCRP 117

Query: 231 RHLPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPCCLAS 58
               P   +S C   +C  PS CRP   + SC        S CRP        CC++S
Sbjct: 118 SCCRPSCCISSCCRPSCCRPSCCRPSCCISSCCRPSCCVSSCCRP-------QCCISS 168

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 21/64 (32%), Positives = 27/64 (41%)
 Frame = -2

Query: 249 PSCGSSRHLPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPC 70
           PSC  S    PQ     C  + C  P+ CRP   + SC       P+ CRP        C
Sbjct: 37  PSCCVSSCCRPQ-----CCQSLCCQPTCCRPSCCISSC-----CRPTCCRPT-------C 79

Query: 69  CLAS 58
           C++S
Sbjct: 80  CISS 83

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 30/113 (26%), Positives = 36/113 (31%)
 Frame = -2

Query: 405 CCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSHMPSCGSSRH 226
           CC S    P  C+     +      SC    C   S  +     P   R   PSC  S  
Sbjct: 79  CCISSCCRPTCCRPSCCIS------SCCRPTCCRPSCCISSCCRPSCCR---PSCCISSC 129

Query: 225 LPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPCC 67
             P      C   +C   S CRP   + SC        S CRP    +   CC
Sbjct: 130 CRPSCCRPSCCRPSCCISSCCRPSCCVSSCCRPQCCISSCCRPICCQTT--CC 180

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 19/64 (29%), Positives = 27/64 (41%)
 Frame = -2

Query: 249 PSCGSSRHLPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPC 70
           P C  S    P      C  ++C  P+ CRP   + SC       P+ CRP+       C
Sbjct: 47  PQCCQSLCCQPTCCRPSCCISSCCRPTCCRPTCCISSC-----CRPTCCRPS-------C 94

Query: 69  CLAS 58
           C++S
Sbjct: 95  CISS 98

>ref|NP_083889.1| RIKEN cDNA 2310037K05 [Mus musculus] gi|12844600|dbj|BAB26426.1|
           unnamed protein product [Mus musculus]
          Length = 168

 Score = 44.3 bits (103), Expect = 9e-04
 Identities = 37/119 (31%), Positives = 43/119 (36%), Gaps = 5/119 (4%)
 Frame = -2

Query: 408 RCCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSHMPSCGSSR 229
           +CC S+   P  C+            SC  + C   S        P   R   PSC  S 
Sbjct: 33  QCCQSVCCQPTCCRP-----------SCCISSCCRPSCC-----RPSCCR---PSCCVSS 73

Query: 228 HLPPQ*RLSPCAHATCPAPSLCRPPANLCSC--PYNGTTH---PSPCRPARSDSVVPCC 67
              PQ   S C   TC  PS CRP   + SC  P  G +     S CRP       PCC
Sbjct: 74  CCRPQCCQSACCQPTCCRPSCCRPSCCISSCCQPSCGGSSCCGSSCCRPCCRPCCRPCC 132

 Score = 35.8 bits (81), Expect = 0.31
 Identities = 23/64 (35%), Positives = 27/64 (41%)
 Frame = -2

Query: 249 PSCGSSRHLPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPC 70
           PSC  S    PQ   S C   TC     CRP   + SC       PS CRP+       C
Sbjct: 22  PSCCVSSCCRPQCCQSVCCQPTC-----CRPSCCISSCCRPSCCRPSCCRPS-------C 69

Query: 69  CLAS 58
           C++S
Sbjct: 70  CVSS 73

>emb|CAC27578.1| keratin associated protein 4.7 [Homo sapiens]
          Length = 210

 Score = 41.6 bits (96), Expect = 0.006
 Identities = 33/115 (28%), Positives = 38/115 (32%)
 Frame = -2

Query: 408 RCCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSHMPSCGSSR 229
           RCC S    P  C +         +  C  T C         H +  +     PSC  SR
Sbjct: 78  RCCISSCCRPSCCMSSCCKPQCCQSVCCQPTCC---------HPSCCISSCCRPSCCVSR 128

Query: 228 HLPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPCCL 64
              PQ   S C   TC  PS C       SC  +    P  CRP        CCL
Sbjct: 129 CCRPQCCQSVCCQPTCCRPSCCISSCCRPSCCESSCCRPCCCRPC-------CCL 176

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 35/128 (27%), Positives = 41/128 (31%), Gaps = 11/128 (8%)
 Frame = -2

Query: 408 RCCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSHM------- 250
           +CC S+   P  C             SC  + C   S  V R   P   +S         
Sbjct: 98  QCCQSVCCQPTCCHP-----------SCCISSCCRPSCCVSRCCRPQCCQSVCCQPTCCR 146

Query: 249 PSCGSSRHLPPQ*RLSPCAHATCPAPSLC-RPPANLCSCPYNGTTHPSPCRPARSDSVVP 73
           PSC  S    P    S C    C  P  C RP     SC      H +  RP    S  P
Sbjct: 147 PSCCISSCCRPSCCESSCCRPCCCRPCCCLRPVCGRVSC------HTTCYRPTCVISTCP 200

Query: 72  ---CCLAS 58
              CC +S
Sbjct: 201 RPLCCASS 208

 Score = 32.0 bits (71), Expect = 4.5
 Identities = 28/100 (28%), Positives = 36/100 (36%), Gaps = 12/100 (12%)
 Frame = -2

Query: 330 SCNTTKCFHESIGVRRHDAPMVLRSHM-------PSCGSSRHLPPQ*RLSPCAHATCPAP 172
           +C  T C+  S  V     P   +S         PSC  +    P+  +S C   +C   
Sbjct: 33  TCCRTTCYRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCETTCCHPRCCISSCCRPSCCMS 92

Query: 171 SLCRPPANLCSCPYNGTTHP-----SPCRPARSDSVVPCC 67
           S C+P      C      HP     S CRP  S  V  CC
Sbjct: 93  SCCKPQCCQSVCCQPTCCHPSCCISSCCRP--SCCVSRCC 130

>ref|XP_210345.2| similar to keratin associated protein 4-12; keratin associated
           protein 4.12 [Homo sapiens]
          Length = 409

 Score = 40.8 bits (94), Expect = 0.010
 Identities = 27/117 (23%), Positives = 41/117 (34%)
 Frame = -2

Query: 405 CCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSHMPSCGSSRH 226
           C   +  +PV+C+     +       C  T C           +  V   + P C  +  
Sbjct: 68  CAQPLCCDPVICEPSCSVSSGCQPVCCEATTC---------EPSCSVSNCYQPVCFEATI 118

Query: 225 LPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPCCLASG 55
             P   +S C    C   ++C P  ++ SC       P+ C P  S SV  CC   G
Sbjct: 119 CEPSCSVSNCCQPVCFEATVCEPSCSVSSCAQPVCCEPAICEP--SCSVSSCCQPVG 173

 Score = 36.2 bits (82), Expect = 0.24
 Identities = 26/105 (24%), Positives = 40/105 (37%), Gaps = 2/105 (1%)
 Frame = -2

Query: 405 CCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSH--MPSCGSS 232
           C  S    PV C+A      T    SC+ + C+           P    S+   P C  +
Sbjct: 83  CSVSSGCQPVCCEA------TTCEPSCSVSNCYQPVCFEATICEPSCSVSNCCQPVCFEA 136

Query: 231 RHLPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRP 97
               P   +S CA   C  P++C P  ++ SC     +  + C+P
Sbjct: 137 TVCEPSCSVSSCAQPVCCEPAICEPSCSVSSCCQPVGSEATSCQP 181

>emb|CAC27580.1| keratin associated protein 4.9 [Homo sapiens]
          Length = 191

 Score = 40.4 bits (93), Expect = 0.013
 Identities = 30/114 (26%), Positives = 37/114 (32%)
 Frame = -2

Query: 405 CCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSHMPSCGSSRH 226
           CC S    P  C+             C TT C         H    +     PSC  S  
Sbjct: 65  CCVSSCCRPQCCQPVCCQPTCCRPSCCETTCC---------HPRCCISSCCRPSCCVSSC 115

Query: 225 LPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPCCL 64
             PQ     C  + C  P+ CRP  ++ SC        S CRP        CC+
Sbjct: 116 CKPQ-----CCQSVCCQPNCCRPSCSISSCCRPSCCESSCCRPC-------CCV 157

 Score = 33.1 bits (74), Expect = 2.0
 Identities = 33/118 (27%), Positives = 39/118 (32%), Gaps = 5/118 (4%)
 Frame = -2

Query: 405 CCWSIVANPVVCKAFVRYNVTFGAYSCNTTKCFHESIGVRRHDAPMVLRSHMPSCGSSRH 226
           CC S    P  C++ V    T    SC  T C   +              + PSC  S  
Sbjct: 25  CCVSSCCRPQCCQS-VCCQPTCSRPSCCQTTCCRTTC-------------YRPSCCVSSC 70

Query: 225 LPPQ*RLSPCAHATCPAPS-----LCRPPANLCSCPYNGTTHPSPCRPARSDSVVPCC 67
             PQ     C   TC  PS      C P   + SC        S C+P    SV  CC
Sbjct: 71  CRPQCCQPVCCQPTCCRPSCCETTCCHPRCCISSCCRPSCCVSSCCKPQCCQSV--CC 126

 Score = 32.0 bits (71), Expect = 4.5
 Identities = 21/61 (34%), Positives = 23/61 (37%)
 Frame = -2

Query: 249 PSCGSSRHLPPQ*RLSPCAHATCPAPSLCRPPANLCSCPYNGTTHPSPCRPARSDSVVPC 70
           PSC  S    PQ   S C   TC  PS C+      +C        S CRP     V  C
Sbjct: 23  PSCCVSSCCRPQCCQSVCCQPTCSRPSCCQTTCCRTTCYRPSCCVSSCCRPQCCQPV--C 80

Query: 69  C 67
           C
Sbjct: 81  C 81



EST assemble image


clone accession position
1 CL08h02_r AV393521 1 508
2 CL08h01_r AV393500 2 507




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research