KCC000181A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000181A_C01 KCC000181A_c01
tgcatcgtcattatcgttgtcgaatgcatcgtcattggctcgtggatcaacccgaggcgg
gggctttggcgcagtgggcgCTGTGCTCGGGAGCGTGACGGGCTTTAACCTTCTGTTTCA
CAGGGATGCTGGTCTGCGGAAGACATTCAACTCCATTGACCTGGATGGCAAGGGCCACAT
CACGGAGAAGGATCTGGAGGCGTTTGCCAACCGCAACGGGCTCCCGGGCAGCTACGCGCA
GCACTTTGTGAGCGCCGTGTTGTCTAGCCACAACGGCAGCACGCAGACAAGCGCGCAGCC
CACGGGCGCCGGCAAGCTGCTGGGGAGGCGGTGCCGCTGGAGGACGTTGATCACTCGGAA
GATGTGGAGCTCACGTTTGCGCTGTTCAAGAACTTCGTACGCAGCCGGGAGGACGCGTTG
CGGCGGGCCTTCAACATGTTCGACCAGGACGGCGACGGGCTGCATCTCGCTGGGCGACCT
GGATGCCACGCTGTCCCGCGTGGCGGTGTGCTGCCCCAAAACCCGCTGCATCTACCGCTG
CCGCTCGCACATGGCGGAGCGCCTGCACTCCAAAGTGGCGACCGACCACGGGTCTCTGGG
TTTCTCGGAGTTCCGTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000181A_C01 KCC000181A_c01
         (617 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_300853.1| hypothetical protein XP_300853 [Homo sapiens]         42  0.009
ref|NP_064121.1| pr5 [Rat cytomegalovirus] gi|9800242|gb|AAF9911...    41  0.012
emb|CAB46679.1| proteophosphoglycan [Leishmania major]                 41  0.012
ref|NP_872435.1| hypothetical protein FLJ35107 [Homo sapiens] gi...    41  0.016
ref|XP_283106.1| hypothetical protein XP_283106 [Mus musculus]         40  0.027

>ref|XP_300853.1| hypothetical protein XP_300853 [Homo sapiens]
          Length = 252

 Score = 41.6 bits (96), Expect = 0.009
 Identities = 38/141 (26%), Positives = 60/141 (41%), Gaps = 4/141 (2%)
 Frame = -1

Query: 581 SPLWSAGAPPCASGSGRCSGFWGSTPPRGTAWHPGR----PARCSPSPSWSNMLKARRNA 414
           SP  S+ +P  +S S   S    S+ P  ++         P+  SPS S S+   +  + 
Sbjct: 127 SPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSP 186

Query: 413 SSRLRTKFLNSANVSSTSSE*STSSSGTASPAACRRPWAARLSACCRCG*TTRRSQSAAR 234
           SS   +   +S++ S  SS  S+SSS T+SP++                 ++  S S + 
Sbjct: 187 SSSSSSPSSSSSSPSPRSSSPSSSSSSTSSPSS-----------------SSPSSSSPSS 229

Query: 233 SCPGARCGWQTPPDPSP*CGP 171
           SCP A  G +     S  C P
Sbjct: 230 SCPSAALGRRPQSPQSSHCAP 250

 Score = 37.4 bits (85), Expect = 0.17
 Identities = 43/174 (24%), Positives = 71/174 (40%)
 Frame = -1

Query: 581 SPLWSAGAPPCASGSGRCSGFWGSTPPRGTAWHPGRPARCSPSPSWSNMLKARRNASSRL 402
           S + S+  P  +S S   S    S+ P  +       +  SPS S S    +  ++SS  
Sbjct: 48  SSILSSSIPSSSSSSSSPSSSPSSSSPSSSH------SSSSPSSSSSTSSPSSSSSSSSS 101

Query: 401 RTKFLNSANVSSTSSE*STSSSGTASPAACRRPWAARLSACCRCG*TTRRSQSAARSCPG 222
                NS++ SS+SS  S+SSS ++SP++     ++  S+       +  S S + S   
Sbjct: 102 SPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSS--PSSSSSSPSSSSSS 159

Query: 221 ARCGWQTPPDPSP*CGPCHPGQWS*MSSADQHPCETEG*SPSRSRAQRPLRQSP 60
           +     +P   SP      P      SS++  P  +     S S +  P   SP
Sbjct: 160 SSSSSSSPSSSSPSSSGSSP------SSSNSSPSSSSSSPSSSSSSPSPRSSSP 207

 Score = 33.1 bits (74), Expect = 3.3
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 2/136 (1%)
 Frame = -1

Query: 569 SAGAPPCASGSGRCSGFWGSTPPRGTAWHPGRPARCSPSPSWSNMLKARRNASSRLRTKF 390
           S+ + P +S S   S    S+P   ++     P+  S SPS S+   +   +SS      
Sbjct: 98  SSSSSPSSSNSSSSSS--SSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSS 155

Query: 389 LNSANVSSTSSE*STS--SSGTASPAACRRPWAARLSACCRCG*TTRRSQSAARSCPGAR 216
            +S++ SS+SS  S+S  SSG++  ++   P ++  S        + RS S + S     
Sbjct: 156 SSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPSSSSSSPSSSSSSPSPRSSSPSSSSSSTS 215

Query: 215 CGWQTPPDPSP*CGPC 168
               + P  S     C
Sbjct: 216 SPSSSSPSSSSPSSSC 231

>ref|NP_064121.1| pr5 [Rat cytomegalovirus] gi|9800242|gb|AAF99116.1|AF232689_7 pr5
           [rat cytomegalovirus Maastricht]
          Length = 629

 Score = 41.2 bits (95), Expect = 0.012
 Identities = 40/141 (28%), Positives = 57/141 (40%), Gaps = 2/141 (1%)
 Frame = -1

Query: 614 GTPRNPETRGRSPLWSAGAPPCASGSGRCSGFWGSTPPRGTAWHPGRPARCSPSPSWSNM 435
           G+ R P T    P  +A +      S  C G   + P  G++  P R  RC  SP W   
Sbjct: 497 GSARGPTTW---PASTAASCTTRRSSSTCRG--AARPRDGSSPTPARSGRCPWSPPWPRP 551

Query: 434 LKARRNASSRLRTKFLNSANVSSTSSE*STSSSGTASPAACRRPWAARLSACCRCG*TTR 255
             A  +    +R    +S++ SS +   S+S + T  P       A+R +   RC  T R
Sbjct: 552 GSAAASTGRGIRGSSPSSSSRSSATGTDSSSGTWTGRPTGTASRSASRPA---RCTSTPR 608

Query: 254 RSQSAARSCPGAR--CGWQTP 198
            S S+    P A   C   TP
Sbjct: 609 ASASSGGGTPRAATWCRRSTP 629

>emb|CAB46679.1| proteophosphoglycan [Leishmania major]
          Length = 873

 Score = 41.2 bits (95), Expect = 0.012
 Identities = 45/181 (24%), Positives = 72/181 (38%), Gaps = 2/181 (1%)
 Frame = -1

Query: 599  PETRGRSPLWSAGAPPCASGSGRCSGFWGSTPPRGTAWHPGRPARCSPSPSWSNMLKARR 420
            P +   +P  S+ + P +S S   S    S P   ++  P   +  +PS S S       
Sbjct: 647  PSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS-----AP 701

Query: 419  NASSRLRTKFLNSANVSSTSSE*STSSSGTASPAACRRPWAARLSACCRCG*TTRRSQSA 240
            +ASS       +SA  +S+SS  S+SSS   S ++   P ++  SA      +   S S+
Sbjct: 702  SASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 761

Query: 239  A--RSCPGARCGWQTPPDPSP*CGPCHPGQWS*MSSADQHPCETEG*SPSRSRAQRPLRQ 66
            A   S   A     + P  S    P      +  +S+   P  +   +PS S +  P   
Sbjct: 762  APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS 821

Query: 65   S 63
            S
Sbjct: 822  S 822

 Score = 36.2 bits (82), Expect = 0.39
 Identities = 40/170 (23%), Positives = 69/170 (40%)
 Frame = -1

Query: 599  PETRGRSPLWSAGAPPCASGSGRCSGFWGSTPPRGTAWHPGRPARCSPSPSWSNMLKARR 420
            P +   +P  S+ + P +S S   S    S P   ++  P   +  +PS S S    +  
Sbjct: 709  PSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSS 768

Query: 419  NASSRLRTKFLNSANVSSTSSE*STSSSGTASPAACRRPWAARLSACCRCG*TTRRSQSA 240
            +A S       +S++  S SS  + SSS +++P+A      +  S+      ++    S+
Sbjct: 769  SAPS-------SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS 821

Query: 239  ARSCPGARCGWQTPPDPSP*CGPCHPGQWS*MSSADQHPCETEG*SPSRS 90
            + S P A     + P  S    P      S  SS+   P  +   +PS S
Sbjct: 822  SSSAPSASS--SSAPSSSSSSAPSASSS-SASSSSSSAPSASSSSAPSSS 868

>ref|NP_872435.1| hypothetical protein FLJ35107 [Homo sapiens]
           gi|21751020|dbj|BAC03887.1| unnamed protein product
           [Homo sapiens] gi|33872427|gb|AAH16304.1| FLJ35107
           protein [Homo sapiens]
          Length = 258

 Score = 40.8 bits (94), Expect = 0.016
 Identities = 40/141 (28%), Positives = 61/141 (42%), Gaps = 4/141 (2%)
 Frame = -1

Query: 581 SPLWSAGAPPCASGSGRCSGFWGSTPPRGTAWHPGR----PARCSPSPSWSNMLKARRNA 414
           SP  S+ +P  +S S   S    S+ P  ++         P+  SPS S S+   +  + 
Sbjct: 128 SPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSP 187

Query: 413 SSRLRTKFLNSANVSSTSSE*STSSSGTASPAACRRPWAARLSACCRCG*TTRRSQSAAR 234
           SS   +   +S++ S  SS  S+SSS T+SP+    P ++  S           S S + 
Sbjct: 188 SSSSSSPSSSSSSPSPRSSSPSSSSSSTSSPST-SSPSSSSPS-----------SSSPSS 235

Query: 233 SCPGARCGWQTPPDPSP*CGP 171
           SCP A  G +     S  C P
Sbjct: 236 SCPSAALGRRPQSPQSSHCAP 256

 Score = 35.8 bits (81), Expect = 0.51
 Identities = 43/174 (24%), Positives = 71/174 (40%)
 Frame = -1

Query: 581 SPLWSAGAPPCASGSGRCSGFWGSTPPRGTAWHPGRPARCSPSPSWSNMLKARRNASSRL 402
           S + S+  P  +S S   S    S+ P  +          S SPS S+   +  ++SS  
Sbjct: 48  SSILSSSIPSSSSSSSSPSSSHSSSSPSSS--------HSSSSPSSSSSTSSPSSSSSSS 99

Query: 401 RTKFLNSANVSSTSSE*STSSSGTASPAACRRPWAARLSACCRCG*TTRRSQSAARSCPG 222
            +   +S+N SS+SS  S SSS ++S ++     ++  S+      +   S S+  S   
Sbjct: 100 SSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSSS 159

Query: 221 ARCGWQTPPDPSP*CGPCHPGQWS*MSSADQHPCETEG*SPSRSRAQRPLRQSP 60
           +     + P  S    P   G  S  SS++  P  +     S S +  P   SP
Sbjct: 160 SSSSSSSSPSSS---SPSSSG--SSPSSSNSSPSSSSSSPSSSSSSPSPRSSSP 208

 Score = 34.3 bits (77), Expect = 1.5
 Identities = 42/173 (24%), Positives = 72/173 (41%), Gaps = 2/173 (1%)
 Frame = -1

Query: 569 SAGAPPCASGSGRCSGFWGSTPPRGTAWHPGRPARCSPSPSWSNMLKARRNASSRLRTKF 390
           S+ + P +S S   S    S+P   ++     P+  S SPS S+                
Sbjct: 99  SSSSSPSSSNSSSSSS--SSSPSSSSSSSSSSPSSSSSSPSSSS---------------- 140

Query: 389 LNSANVSSTSSE*STSSSGTASPAACRRPWAARLSACCRCG*TTRRSQSAARSCPGARCG 210
            +S++ S +SS  S SSS ++S ++   P ++  S+      ++  S S++ S P +   
Sbjct: 141 -SSSSSSPSSSSSSPSSSSSSSSSSSSSPSSSSPSSSGSSPSSSNSSPSSSSSSPSSSSS 199

Query: 209 WQTPPDPSP*CGPCHPGQWS*MSSADQHPCETEG*S--PSRSRAQRPLRQSPR 57
             +P   SP          S  S +   P  +   S  PS +  +RP  QSP+
Sbjct: 200 SPSPRSSSPSSSSSSTSSPSTSSPSSSSPSSSSPSSSCPSAALGRRP--QSPQ 250

>ref|XP_283106.1| hypothetical protein XP_283106 [Mus musculus]
          Length = 166

 Score = 40.0 bits (92), Expect = 0.027
 Identities = 56/176 (31%), Positives = 65/176 (36%), Gaps = 2/176 (1%)
 Frame = +3

Query: 9   HYRCRMHRHWLVDQPEAGALAQWALCSGA*RALTFCFTGMLVCGRHSTPLTWMARATSRR 188
           H R R H+ WL     AG        SGA R+ T             T  T+ A AT+  
Sbjct: 16  HPRLRPHQPWLRAPGPAG--------SGARRSPT-------------TAATYAAAATAEA 54

Query: 189 RIWRRLPTATGSRAATRSTL*APCCLATTAA--RRQARSPRAPASCWGGGAAGGR*SLGR 362
                L        A +  L AP      AA     ARSPR P    GG AAG       
Sbjct: 55  AAAASLDALV---TANQDVLGAPTAATRVAAPAAATARSPRHP----GGRAAGAE----S 103

Query: 363 CGAHVCAVQELRTQPGGRVAAGLQHVRPGRRRAASRWATWMPRCPAWRCAAPKPAA 530
                 A +  R + GGR A      R GRR A    A   P CPA   +AP PA+
Sbjct: 104 PAVGPPAARRRRARGGGRGAGPPCAARCGRRAARREDAGRRPHCPAR--SAPAPAS 157



EST assemble image


clone accession position
1 LCL076d02_r AV630266 1 380
2 CL08g08_r AV393536 170 617




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research