KCC000180A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000180A_C01 KCC000180A_c01
ctctaatatgCTAAATTCCAAGCTCTTTCTTATGTATGCGTGCACCAAGGTGCTTTGCAC
TGCACATCTATTTAGCACCGCTGCACTTTCAAACACCAGCGAGTAGATACCAAGCATTCT
ACGTCATGTGCTTAACGTTTTTCTATTAGATAGCGTGCTCTTGGCGCAGGAGCCGCTCGG
AGGCGGGATGCTGTCGGCAAGAGTCCGGCGAGGGTCACGCCCTATTAGCAAATATCTCTC
TGCCCGCGGATCGTATTCCTAGGGCGGGGCGTCGAGCGCCGCGTCAAGCCCCGCGGGTGC
CACGGCACGGGTCTGCGGTTCACGCGGGGGGCTCCGGTGTTCGATCCGCATCACCCCACT
CCTAGATCCTAGCCTTCTCCTCGCCCACTATCAAATACAACACGAATGGACTTCGCTGCC
TACATCAGTGGCCTGCCCGGCCCCAAGCGCGGCGCTCTATACCGCTCCCCCTGGACCTGC
CTAGCCGTTTTCAGGAATCTGCCGCCTCTGGCGCAGGTCTATGTGATGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000180A_C01 KCC000180A_c01
         (529 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_015203.1| Transcription/repair factor TFIIH subunit; Tfb2...    42  0.006
ref|NP_045364.1| immediate-early transactivator protein (cell nu...    38  0.070
gb|AAG34190.1|AC011016_1 L3836.5 [Leishmania major]                    37  0.12
emb|CAE05735.1| OSJNBb0017I01.15 [Oryza sativa (japonica cultiva...    37  0.16
ref|NP_064121.1| pr5 [Rat cytomegalovirus] gi|9800242|gb|AAF9911...    37  0.16

>ref|NP_015203.1| Transcription/repair factor TFIIH subunit; Tfb2p [Saccharomyces
           cerevisiae] gi|2132984|pir||S62000 probable membrane
           protein YPL122c - yeast (Saccharomyces cerevisiae)
           gi|1163092|gb|AAB68240.1| Lph5p
           gi|1778059|gb|AAB40628.1| transcription/repair factor
           TFIIH subunit Tfb2 [Saccharomyces cerevisiae]
          Length = 513

 Score = 41.6 bits (96), Expect = 0.006
 Identities = 17/36 (47%), Positives = 25/36 (69%)
 Frame = +1

Query: 421 YISGLPGPKRGALYRSPWTCLAVFRNLPPLAQVYVM 528
           Y+  +P   +  LY SP TCLA++R LPPLA+ ++M
Sbjct: 13  YLEEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIM 48

>ref|NP_045364.1| immediate-early transactivator protein (cell nucleus) [Bovine
            herpesvirus 1] gi|9629891|ref|NP_045375.1|
            immediate-early transactivator protein (cell nucleus)
            [Bovine herpesvirus 1] gi|291536|gb|AAA03610.1| BICP4
            gi|2653353|emb|CAA06139.1| immediate-early transactivator
            protein (cell nucleus) [Bovine herpesvirus type 1.1]
            gi|2653364|emb|CAA06150.1| immediate-early transactivator
            protein (cell nucleus) [Bovine herpesvirus type 1.2
            (strain K22)]
          Length = 1343

 Score = 38.1 bits (87), Expect = 0.070
 Identities = 24/53 (45%), Positives = 29/53 (54%)
 Frame = +2

Query: 173  PLGGGMLSARVRRGSRPISKYLSARGSYS*GGASSAASSPAGATARVCGSRGG 331
            P GGG    R RRG  P  + LS+  S S   +SSAASSPA +     G+ GG
Sbjct: 1287 PAGGGRRPRRPRRGPPPRVEVLSSSSSSS-SSSSSAASSPASSDDDEAGAAGG 1338

>gb|AAG34190.1|AC011016_1 L3836.5 [Leishmania major]
          Length = 1010

 Score = 37.4 bits (85), Expect = 0.12
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 5/90 (5%)
 Frame = +2

Query: 167 QEPLGGGMLSARVRRGSRPISKYLSAR-GSYS*GGASSAASSPA----GATARVCGSRGG 331
           +EPL     +A  R    P S +++A+ G+Y    A+S+A +PA    GA A +    G 
Sbjct: 618 EEPLSEAFATAVRRYNEDPPSPFMAAKSGTYL---ATSSAGAPAEEKDGAAAAMTAGNGE 674

Query: 332 LRCSIRITPLLDPSLLLAHYQIQHEWTSLP 421
                  TP  DP + L  Y +Q    +LP
Sbjct: 675 DLAGASNTPTRDPMVTLVKYNVQRAMKTLP 704

>emb|CAE05735.1| OSJNBb0017I01.15 [Oryza sativa (japonica cultivar-group)]
          Length = 451

 Score = 37.0 bits (84), Expect = 0.16
 Identities = 17/40 (42%), Positives = 24/40 (59%)
 Frame = +1

Query: 409 DFAAYISGLPGPKRGALYRSPWTCLAVFRNLPPLAQVYVM 528
           +F   ++ LP  K   LY S + C AV R+LPPLA+ Y +
Sbjct: 10  NFMDMVAALPAAKLDMLYDSAFICEAVLRSLPPLAKKYAL 49

>ref|NP_064121.1| pr5 [Rat cytomegalovirus] gi|9800242|gb|AAF99116.1|AF232689_7 pr5
           [rat cytomegalovirus Maastricht]
          Length = 629

 Score = 37.0 bits (84), Expect = 0.16
 Identities = 40/125 (32%), Positives = 52/125 (41%), Gaps = 3/125 (2%)
 Frame = +3

Query: 153 ACSWRRSRSEA-GCCRQESGEGHALLANISLPADRIPRAGRRAPRQAPRVPRHGSAVHAG 329
           +C+ RRS S   G  R   G                P    R P  +P  PR GSA  + 
Sbjct: 512 SCTTRRSSSTCRGAARPRDGSSPT------------PARSGRCP-WSPPWPRPGSAAAST 558

Query: 330 GSGVRSASPHS*ILAFSSPTIKYNTNGLRCLHQWPARP--QARRSIPLPLDLPSRFQESA 503
           G G+R +SP S   + SS T   +++G      W  RP   A RS   P    S  + SA
Sbjct: 559 GRGIRGSSPSS--SSRSSATGTDSSSG-----TWTGRPTGTASRSASRPARCTSTPRASA 611

Query: 504 ASGAG 518
           +SG G
Sbjct: 612 SSGGG 616



EST assemble image


clone accession position
1 HCL095a10_r AV644881 1 533
2 HCL065h04_r AV643220 11 340
3 HCL059b06_r AV642844 12 432
4 CL31e11_r AV395034 16 527
5 CL08g07_r AV393537 33 340
6 LCL079d01_r AV630470 59 201




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research