KCC000179A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000179A_C01 KCC000179A_c01
CTTGATATCGTATGGCACAAATTGATCAACCAAGCCTACACGACGGAGTTCGCTGGGTGG
CTTACTGGTCAGCACGAAGTTTGATGTGAGAAGAAACAACTACTAAGAGTAAGAGCAGCA
GCGCAGATTGAGGATGCAGCGCTTCAAGAAGCTATTCACGAAGGATACCGGGGAAGCGTT
GTCTCTGCCGAGTCCTCCGTCGCTGCACTCACCTTCCGCTCAAACTTCGCCACCTAGCAA
AAGTTCTCCTCAAGCAACTCCTCAGCAGGAGTCACCAGCTGCGGTGCCTGACGACGTTGA
CGAGGTTGGCGAACGCGTATCGACCCTCCCATCCGAGCCTGCACAGCCTCCGAAACTTGA
CTGTGTCAGCCGCGAAAGATGACCCTGTCGCCAAGGATT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000179A_C01 KCC000179A_c01
         (399 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_077437.1| tegument protein [Cercopithecine herpesvirus 7]...    40  0.008
gb|AAM34403.1|AF377947_9 unknown protein [Oryza sativa (japonica...    40  0.010
dbj|BAB39873.1| putative protein kinase [Oryza sativa (japonica ...    39  0.017
ref|XP_290799.2| similar to KIAA1501 protein [Homo sapiens]            39  0.023
sp|P45481|CBP_MOUSE CREB-binding protein gi|481698|pir||S39161 C...    39  0.023

>ref|NP_077437.1| tegument protein [Cercopithecine herpesvirus 7]
            gi|11036566|gb|AAG27195.1|AF275348_15 tegument protein
            [Cercopithecine herpesvirus 7]
          Length = 2653

 Score = 40.0 bits (92), Expect = 0.008
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = +2

Query: 188  PSPPSLHSPSAQTSPPSKSSPQATPQQESPAAVPDDVDEVGERVSTLPSEPAQP 349
            PS P    PS  + P   S P   P Q S A+ P    +  +  S  PS+P+QP
Sbjct: 2444 PSQPPSQPPSQPSQPSQPSQPSQPPSQPSQASQPSQPSQASQPPSQPPSQPSQP 2497

 Score = 36.2 bits (82), Expect = 0.11
 Identities = 21/56 (37%), Positives = 28/56 (49%)
 Frame = +2

Query: 182  SLPSPPSLHSPSAQTSPPSKSSPQATPQQESPAAVPDDVDEVGERVSTLPSEPAQP 349
            S PS PS   PS  + PPS+ S  + P Q S A+ P           + PS+P+QP
Sbjct: 2453 SQPSQPS--QPSQPSQPPSQPSQASQPSQPSQASQPPSQPPSQPSQPSQPSQPSQP 2506

>gb|AAM34403.1|AF377947_9 unknown protein [Oryza sativa (japonica cultivar-group)]
           gi|31712047|gb|AAP68353.1| unknown protein [Oryza sativa
           (japonica cultivar-group)]
          Length = 235

 Score = 39.7 bits (91), Expect = 0.010
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +2

Query: 173 EALSLPSPPSLHSPSAQTSPPSKSSPQATPQQESPAAVPDDVDEVGERVSTLPSEPAQPP 352
           E + LP PP   +P  +  PP K  PQ  P +E     P     + E  +  P    +PP
Sbjct: 74  EIVDLPPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAVIIVEPPAPAPEPEPEPP 133

Query: 353 K 355
           K
Sbjct: 134 K 134

>dbj|BAB39873.1| putative protein kinase [Oryza sativa (japonica cultivar-group)]
          Length = 698

 Score = 38.9 bits (89), Expect = 0.017
 Identities = 20/62 (32%), Positives = 30/62 (48%)
 Frame = +2

Query: 164 DTGEALSLPSPPSLHSPSAQTSPPSKSSPQATPQQESPAAVPDDVDEVGERVSTLPSEPA 343
           DT   +  P PP   SP    +PP   SP  +P + SPA+ P  +   G+ +   P+ P+
Sbjct: 151 DTPPVVQSPPPPHRRSPRTPWAPPMAPSPSGSPTKPSPAS-PSPI--AGDPIIPTPNNPS 207

Query: 344 QP 349
            P
Sbjct: 208 SP 209

 Score = 31.6 bits (70), Expect = 2.8
 Identities = 22/57 (38%), Positives = 25/57 (43%), Gaps = 3/57 (5%)
 Frame = +2

Query: 191 SPPSLHSPSAQTSPPSKSSPQATPQQESPAAVPDDVDEVGERVSTLPSEP---AQPP 352
           SPP    PSA T PP   SP  +P    P AVP          +T+P  P   A PP
Sbjct: 47  SPPL---PSAATPPPQPDSPPPSPPPAPPVAVPPP--------ATVPPPPVPVASPP 92

>ref|XP_290799.2| similar to KIAA1501 protein [Homo sapiens]
          Length = 1454

 Score = 38.5 bits (88), Expect = 0.023
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = +2

Query: 167 TGEALSLPSPPSLHSPSAQTSPPSKSSPQATPQQESPAAVPDD 295
           +GEA S+P PP +  P    +PP+++S +AT   E  +A+P D
Sbjct: 139 SGEARSIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSD 181

>sp|P45481|CBP_MOUSE CREB-binding protein gi|481698|pir||S39161 CREB-binding protein -
            mouse gi|435855|gb|AAB28651.1| CREB-binding protein; CBP
            [Mus sp.]
          Length = 2441

 Score = 38.5 bits (88), Expect = 0.023
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 15/110 (13%)
 Frame = +2

Query: 68   VSTKFDVRRNNY*E*EQQRRLRMQRFKKLFTKDTGEALSLPSPPSL------HSPSAQTS 229
            ++ K +VR+       QQ +L  +R   + T++  +  SLPSP S         PS   +
Sbjct: 1845 LNIKHNVRQQQIQHCLQQAQLMRRRMATMNTRNVPQQ-SLPSPTSAPPGTPTQQPSTPQT 1903

Query: 230  PPSKSSPQATPQQESPAAVPD-------DVDEVGERVSTLPS--EPAQPP 352
            P   + PQ +P   SPA  P+        +   G+  + +P+   PAQPP
Sbjct: 1904 PQPPAQPQPSPVNMSPAGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPP 1953



EST assemble image


clone accession position
1 MXL061a10_r BP096578 1 481
2 CL08g05_r AV393503 219 624




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research