KCC000178A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000178A_C01 KCC000178A_c01
ccataGCTTACCTTGAAAGCTTACATTTAACGCAACTGCACGTGCAAGAAATATCCACAT
AAGACAGCGAACGAGCCCGCTTACTACAAGTTTCGGGAGACGAGCTTCTTGTCGGTTGCC
CACAGACTTAAAAATTGACATCTTGTTGTTAGGCAATGTTTTCGATACGTAGCAGAGCTT
ACGTATAGCTCCGTTCCGTCAGCTGCCGAGGTCCTTCCGCTGCTTCCGCCGAGCGTCGCG
ACCTCTGAAGCACTTCCTGTACGTATGCGATATGGCTTATATGGCGCCAAGCCCCTCTCG
ACAAGCGGGCGCATCGAGTACGTCGGGCAATTCCGATGGCCAGGCCTCCTCCAGAGGGCA
TTCGGGAACCACGCGCGGCGCCCTATCAGGTGTGATGGGCGCGTCGCCCTTCGGTGTTCT
CGCGACGACGCCAGAGCTGCCGACCAGCACGCTGGTGCTGGGACCCACGTCCAGCTCCCC
TCGGCCACTTTTGCCAACGTCCGAGTCGTCCGCGCGCCGGCCC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000178A_C01 KCC000178A_c01
         (523 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAO47242.1| merozoite surface protein-1 [Plasmodium falciparu...    41  0.008
gb|AAO47243.1| merozoite surface protein-1 [Plasmodium falciparum]     40  0.018
gb|AAC69721.1| merozoite surface protein 1 [Plasmodium falciparum]     40  0.018
pir||S16752 major merozoite surface antigen MSA-1 - malaria para...    39  0.031
emb|CAA43932.1| major surface antigen [Plasmodium falciparum]          39  0.031

>gb|AAO47242.1| merozoite surface protein-1 [Plasmodium falciparum]
           gi|28569091|gb|AAO47247.1| merozoite surface protein-1
           [Plasmodium falciparum] gi|28569095|gb|AAO47249.1|
           merozoite surface protein-1 [Plasmodium falciparum]
           gi|28569227|gb|AAO47315.1| merozoite surface protein-1
           [Plasmodium falciparum]
          Length = 107

 Score = 41.2 bits (95), Expect = 0.008
 Identities = 30/75 (40%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +2

Query: 296 SRQAGASSTSGNSDGQASSRGHSGTTRGALSGVMGAS-PFGVLATTPELPTSTLVLGPTS 472
           S Q+G S TSG S G + + G SGT+    SG  G S P G   T+P   ++TL    TS
Sbjct: 13  SAQSGTSGTSGTS-GTSGTSGTSGTS--GTSGTSGTSGPSGPSGTSPSSRSNTLPRSNTS 69

Query: 473 SSPRPLLPTSESSAR 517
           S   P    S+S A+
Sbjct: 70  SGASPPADASDSDAK 84

>gb|AAO47243.1| merozoite surface protein-1 [Plasmodium falciparum]
          Length = 104

 Score = 40.0 bits (92), Expect = 0.018
 Identities = 30/75 (40%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 296 SRQAGASSTSGNSDGQASSRGHSGTTRGALSGVMGAS-PFGVLATTPELPTSTLVLGPTS 472
           S Q+G S TSG S G + + G SGT     SG  G S P G   T+P   ++TL    TS
Sbjct: 13  SAQSGTSGTSGTS-GTSGTSGTSGT-----SGTSGTSGPSGPSGTSPSSRSNTLPRSNTS 66

Query: 473 SSPRPLLPTSESSAR 517
           S   P    S+S A+
Sbjct: 67  SGASPPADASDSDAK 81

>gb|AAC69721.1| merozoite surface protein 1 [Plasmodium falciparum]
          Length = 369

 Score = 40.0 bits (92), Expect = 0.018
 Identities = 30/75 (40%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +2

Query: 296 SRQAGASSTSGNSDGQASSRGHSGTTRGALSGVMGAS-PFGVLATTPELPTSTLVLGPTS 472
           S Q+G S TSG S G + + G SGT+    SG  G S P G   T+P   ++TL    TS
Sbjct: 64  SAQSGTSGTSGTS-GTSGTSGTSGTS--GTSGPSGPSGPSGPSGTSPSSRSNTLPRSNTS 120

Query: 473 SSPRPLLPTSESSAR 517
           S   P    S+S A+
Sbjct: 121 SGASPPADASDSDAK 135

>pir||S16752 major merozoite surface antigen MSA-1 - malaria parasite
           (Plasmodium falciparum) (fragments)
          Length = 1086

 Score = 39.3 bits (90), Expect = 0.031
 Identities = 30/75 (40%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 296 SRQAGASSTSGNSDGQASSRGHSGTTRGALSGVMGAS-PFGVLATTPELPTSTLVLGPTS 472
           S Q+G S TSG S G + + G SGT     SG  G S P G   T+P   ++TL    TS
Sbjct: 64  SAQSGTSGTSGTS-GTSGTSGTSGT-----SGTSGTSGPSGPSGTSPSSRSNTLPRSNTS 117

Query: 473 SSPRPLLPTSESSAR 517
           S   P    S+S A+
Sbjct: 118 SGAIPPADASDSDAK 132

>emb|CAA43932.1| major surface antigen [Plasmodium falciparum]
          Length = 1087

 Score = 39.3 bits (90), Expect = 0.031
 Identities = 30/75 (40%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 296 SRQAGASSTSGNSDGQASSRGHSGTTRGALSGVMGAS-PFGVLATTPELPTSTLVLGPTS 472
           S Q+G S TSG S G + + G SGT     SG  G S P G   T+P   ++TL    TS
Sbjct: 64  SAQSGTSGTSGTS-GTSGTSGTSGT-----SGTSGTSGPSGPSGTSPSSRSNTLPRSNTS 117

Query: 473 SSPRPLLPTSESSAR 517
           S   P    S+S A+
Sbjct: 118 SGAIPPADASDSDAK 132



EST assemble image


clone accession position
1 LCL020h06_r AV627088 1 258
2 HCL007f12_r AV639944 6 517
3 CL08g01_r AV393499 7 483
4 HCL011f05_r AV640175 12 198
5 MXL091b10_r BP098303 14 371
6 MXL053c01_r BP096128 14 523




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research