KCC000177A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000177A_C01 KCC000177A_c01
CTGAGTTCTTGTGAACAACGGCTATCGAGCTTGCGGAAACGCACAAACCTGCTCGCGCTC
TGAGCGCTCTAGGAACGCTTTTGCCTTATCGACTGCACTAGGAACGCTTTAATTATCGAC
TGCATTATCTAGCATCCATTCTGAACCTGCAACGAGCCATGGACTAGTTTACACGCCTCG
GCCCCGGCGCCTGGCCATGTTTTCGTGTCGCAAGGGGCTACAGCCCCCTTGCTTGCTGCC
TGCTGCGCTGCTGGCTGTGCTGCTGCTCCTGGGCAGCGCCGAGGGCCAGTCAGAGTCGCC
GGCTCTCAGCCTGGCGTCCGTTCCAGCATGGGACGACCCCTCAGTAGCGTTGATTTCTAC
TGGTTTGGAGCTGGCGGACGCTCTCGCTAATCCCAATAAAACCTGGGCGATTCTCACGAA
GGACGTCGTCGTCACCGACTCTGACTTCTCAGCCTATGCCCAGCCTATACCTCGCATATC
AAATTTTACTATCACTGGCAATCAGACGTTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000177A_C01 KCC000177A_c01
         (511 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_325419.1| hypothetical protein [Neurospora crassa] gi|289...    37  0.19
pir||T50706 hypothetical protein 173 [imported] - Rhodobacter sp...    36  0.25
ref|ZP_00023022.1| COG3170: Tfp pilus assembly protein FimV [Ral...    36  0.32
ref|NP_031593.1| bassoon; presynaptic cytomatrix protein [Mus mu...    35  0.42
gb|AAF16723.1|AF117601_1 putative cuticle protein [Manduca sexta...    35  0.71

>ref|XP_325419.1| hypothetical protein [Neurospora crassa] gi|28922019|gb|EAA31290.1|
            hypothetical protein [Neurospora crassa]
          Length = 1051

 Score = 36.6 bits (83), Expect = 0.19
 Identities = 33/107 (30%), Positives = 47/107 (43%), Gaps = 4/107 (3%)
 Frame = -2

Query: 450  EKSESVTTTSFV----RIAQVLLGLARASASSKPVEINATEGSSHAGTDARLRAGDSDWP 283
            +++ SV +TS      R +  L G +  S +S  V I    GSS  G   R     S  P
Sbjct: 843  DEAASVVSTSSTSRSHRFSSALFGKSPTSGASSAVTIRGGRGSSTGGQQRRNFTDTSTAP 902

Query: 282  SALPRSSSTASSAAGSKQGGCSPLRHENMARRRGRGV*TSPWLVAGS 142
            +     S +ASS+ G   GG S   HE     RG+   T+P+  + S
Sbjct: 903  TT--TGSPSASSSGGGGGGGGSCAGHEG----RGQSPSTTPYFSSHS 943

>pir||T50706 hypothetical protein 173 [imported] - Rhodobacter sphaeroides
           gi|6690682|gb|AAF24250.1| Orf173 [Rhodobacter
           sphaeroides]
          Length = 173

 Score = 36.2 bits (82), Expect = 0.25
 Identities = 22/82 (26%), Positives = 34/82 (40%)
 Frame = -2

Query: 381 ASASSKPVEINATEGSSHAGTDARLRAGDSDWPSALPRSSSTASSAAGSKQGGCSPLRHE 202
           +S    P  +  T G+   G  A      S W S  PR S+  +  + +   G +  +  
Sbjct: 38  SSVQGAPSRVRITRGTGSPGATASRCRSASVWHSVTPRGSAALAIFSTNAPRGVASRKFW 97

Query: 201 NMARRRGRGV*TSPWLVAGSEW 136
           + +  RGR V +SP  V  S W
Sbjct: 98  SRSEVRGRAVPSSPKWVRASPW 119

>ref|ZP_00023022.1| COG3170: Tfp pilus assembly protein FimV [Ralstonia metallidurans]
          Length = 979

 Score = 35.8 bits (81), Expect = 0.32
 Identities = 29/81 (35%), Positives = 38/81 (46%), Gaps = 1/81 (1%)
 Frame = +2

Query: 41  AQTCSRSERSRNAFALSTALGTL*LSTALSSIHSEPATSHGLVYTPRPRRLAMFSCRKG- 217
           AQ  S S+    A A +TA  +   +   ++  S PA +   V  P+P  L   S   G 
Sbjct: 513 AQAASASDAQAAAPATATAAASAPKAATAAAAASAPAAAKKPVALPKPEPLPQPSLLDGL 572

Query: 218 LQPPCLLPAALLAVLLLLGSA 280
           L  P LLP A L V+LL G A
Sbjct: 573 LANPMLLPGAALMVVLLGGYA 593

>ref|NP_031593.1| bassoon; presynaptic cytomatrix protein [Mus musculus]
           gi|11360352|pir||T42730 Bassoon protein - mouse
           gi|3413810|emb|CAA76598.1| Bassoon [Mus musculus]
          Length = 3942

 Score = 35.4 bits (80), Expect = 0.42
 Identities = 29/70 (41%), Positives = 30/70 (42%), Gaps = 12/70 (17%)
 Frame = -3

Query: 317 TPG*--EPATLTGPRRCPGAAAQP----------AAQQAASKGAVAPCDTKTWPGAGAEA 174
           TPG   EP   TGP   PGA A+           A  QAASK A  P   KT P   A A
Sbjct: 407 TPGAKTEPGARTGPGSGPGALAKTGGTASPKHGRAEHQAASKAAAKP---KTMPKERAAA 463

Query: 173 CKLVHGSLQV 144
           C L    L V
Sbjct: 464 CPLCQAELNV 473

>gb|AAF16723.1|AF117601_1 putative cuticle protein [Manduca sexta] gi|28261395|gb|AAO32819.1|
           putative cuticle protein [Manduca sexta]
          Length = 186

 Score = 34.7 bits (78), Expect = 0.71
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
 Frame = +1

Query: 172 HASAPAPGHVFVSQGATAPLLAACCAAGCAAAP----GQRRGPVRVAGSQPG-VRSSMGR 336
           H +AP    V  +    AP++AA      AAAP       RGPV +A  QP  + ++ GR
Sbjct: 42  HLAAPVAPVVAAAPVVAAPVVAAAAGPVVAAAPLHPGSNYRGPVSLAPGQPATILAADGR 101

Query: 337 PLSSV 351
           PL ++
Sbjct: 102 PLDTL 106



EST assemble image


clone accession position
1 CL08f12_r AV393540 1 584
2 MXL062a06_r BP096626 72 532
3 MXL081g02_r BP097812 74 501
4 MXL016f10_r BP093994 75 603
5 MXL019e10_r BP094206 77 597
6 HCL023g04_r AV640864 78 473
7 MXL048f04_r BP095875 91 485
8 MXL053c04_r BP096130 91 465
9 HCL029a10_r AV641171 92 586




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research