KCC000176A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000176A_C01 KCC000176A_c01
tgtggcgttgctggttggcacattcatcctccgcaCGCGGGGGCCAGCACCGGACGGGCT
GGGTGCTGGCGGCAGGTGGCACGGTGCTGGTTGTGGGGTGCATGCGTGGAGGCGCTGCGG
CAGCCGAATTGGCCCGCGCCGCGCTCGCATGGCGTCAGCACGTCTTGCTTTAGGTCAGAA
CCGTCCATGGTTTTGCGTCTAGACCCTATTCGTTACTAGCATGGCTGAGGCGTGTCGCCC
TACCCGGGGACAGGCGAATGTACGGTTAGCTAGACAAGTGGGACTGAAGACATTCTTGTC
CCAAGAGCTGTGGGGGTGTCTGCTTGGGCTTGCGGTGGTCAGTCGGGATGTGCGGGCCGC
ATGCGCAGTGCGACCTGGTGCGACAGACGGCCGATGTGTGCAGGGCGTGGGTGTTGACTC
TTGTGTGCGGACGTGGACTTCGCGACATTGCAGCTTTCAGTGCACGACCGACAGAACACT
GGTCGTGTGTAAGACATAAGATCAT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000176A_C01 KCC000176A_c01
         (505 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_501173.1| putative protein (4I100) [Caenorhabditis elegan...    33  0.018
gb|AAC82365.1| unknown [Myxococcus xanthus]                            39  0.028
gb|AAG13426.1|AC051634_7 hypothetical protein [Oryza sativa (jap...    38  0.062
gb|AAL40377.1|AC087333_4 Brain ankyrin 2 [Takifugu rubripes]           33  0.37
emb|CAB96906.1| FRANK2 protein [Takifugu rubripes]                     33  0.38

>ref|NP_501173.1| putative protein (4I100) [Caenorhabditis elegans]
            gi|7331850|gb|AAF60538.1| Hypothetical protein Y40C5A.3
            [Caenorhabditis elegans]
          Length = 2344

 Score = 32.7 bits (73), Expect(2) = 0.018
 Identities = 15/39 (38%), Positives = 20/39 (50%)
 Frame = -2

Query: 429  RTQESTPTPCTHRPSVAPGRTAHAARTSRLTTASPSRHP 313
            ++Q++ PTP THRP + P         S L T S S  P
Sbjct: 1452 QSQQTRPTPTTHRPGITPPLAPKTIYPSSLQTGSSSPTP 1490

 Score = 26.2 bits (56), Expect(2) = 0.018
 Identities = 12/27 (44%), Positives = 16/27 (58%)
 Frame = -3

Query: 482  PVFCRSCTESCNVAKSTSAHKSQHPRP 402
            PV   + T   N+A ST+ H+SQ  RP
Sbjct: 1432 PVAPPTVTVPSNIAPSTTGHQSQQTRP 1458

>gb|AAC82365.1| unknown [Myxococcus xanthus]
          Length = 542

 Score = 39.3 bits (90), Expect = 0.028
 Identities = 40/131 (30%), Positives = 43/131 (32%), Gaps = 5/131 (3%)
 Frame = -2

Query: 429 RTQESTPTPCTHRPSVAPGRTAHAARTSRLTTASPS-RHPHSSWDKNVFSPTCLANRTFA 253
           RT      P T   S  P +        R    SP  R  H       F PTC       
Sbjct: 29  RTPPGARPPPTETASYPPPQAVPGPCAPRAPPRSPPPRRRHRGSRHRSFRPTCARRSGRR 88

Query: 252 CPRVGRHASAMLVTNRV*TQNHGRF*PKARRADAMRARR-GPIRLPQRLHACTPQPAP-- 82
           CP   RH                     ARR  A  +RR GP R       CTP PAP  
Sbjct: 89  CPAPSRH---------------------ARRNPAGPSRRCGPPRKSTPTRCCTPCPAPPR 127

Query: 81  CHL-PPAPSPS 52
           C   P AP+PS
Sbjct: 128 CRARPSAPAPS 138

>gb|AAG13426.1|AC051634_7 hypothetical protein [Oryza sativa (japonica cultivar-group)]
          Length = 333

 Score = 38.1 bits (87), Expect = 0.062
 Identities = 24/55 (43%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
 Frame = -2

Query: 165 RRADAMRARRGPIRLPQRLHACTPQPAPCHLPPAPSPSGAGPRVRR---MNVPTS 10
           RR   + A  GP R P+R  A  P P P  LPPAP+P  AG R      ++ PTS
Sbjct: 61  RRRAHVSASSGP-RRPRRACAAFPAPTPLSLPPAPAPEMAGIRFSNPASLSSPTS 114

>gb|AAL40377.1|AC087333_4 Brain ankyrin 2 [Takifugu rubripes]
          Length = 2027

 Score = 33.1 bits (74), Expect(2) = 0.37
 Identities = 27/75 (36%), Positives = 31/75 (41%), Gaps = 9/75 (12%)
 Frame = -3

Query: 419  SQHPRPAH-----IGRLSHQVALRMRPAHPD*PPQAQADTPTALGTRM----SSVPLV*L 267
            SQ P P H     +G  S   A  ++PA P  PP+   D   AL        SS P    
Sbjct: 908  SQTPSPPHPPIKVVGDSSRTPAAGLKPATPQLPPKPALDLVPALTASQVGSCSSCP---- 963

Query: 266  TVHSPVPG*GDTPQP 222
               SP PG G  PQP
Sbjct: 964  ---SPGPGRGPRPQP 975

 Score = 21.2 bits (43), Expect(2) = 0.37
 Identities = 13/33 (39%), Positives = 15/33 (45%)
 Frame = -1

Query: 136  RANSAAAAPPRMHPTTSTVPPAASTQPVRCWPP 38
            R   AAAA     P  STV   +ST  +   PP
Sbjct: 972  RPQPAAAACAECPPVVSTVTTVSSTSSIN--PP 1002

>emb|CAB96906.1| FRANK2 protein [Takifugu rubripes]
          Length = 1596

 Score = 33.1 bits (74), Expect(2) = 0.38
 Identities = 27/75 (36%), Positives = 31/75 (41%), Gaps = 9/75 (12%)
 Frame = -3

Query: 419 SQHPRPAH-----IGRLSHQVALRMRPAHPD*PPQAQADTPTALGTRM----SSVPLV*L 267
           SQ P P H     +G  S   A  ++PA P  PP+   D   AL        SS P    
Sbjct: 424 SQTPSPPHPPIKVVGDSSRTPAAGLKPATPQLPPKPALDLVPALTASQVGSCSSCP---- 479

Query: 266 TVHSPVPG*GDTPQP 222
              SP PG G  PQP
Sbjct: 480 ---SPGPGRGPRPQP 491

 Score = 21.2 bits (43), Expect(2) = 0.38
 Identities = 13/33 (39%), Positives = 15/33 (45%)
 Frame = -1

Query: 136 RANSAAAAPPRMHPTTSTVPPAASTQPVRCWPP 38
           R   AAAA     P  STV   +ST  +   PP
Sbjct: 488 RPQPAAAACAECPPVVSTVTTVSSTSSIN--PP 518



EST assemble image


clone accession position
1 HCL098a12_r AV645088 1 444
2 MX010f11_r BP086524 36 503
3 CL08f09_r AV393526 195 508
4 LC099h05_r AV625923 213 549




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research