KCC000175A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000175A_C01 KCC000175A_c01
ctaggctcccctgcaacaggccgtgtgcccagttagggcaacaacgggcccgctagtcct
cacgtggagggcaagggccgCCAGTAATTCTGGTGCCGTTCAACACCCCTCGTCGAGGGT
GGCAGGGCCGCTACACCCACGGCAATGGGAGGCGGGCGAGCCGGGGGGAGGCGGGCATCC
TAGCTGCCGCCCGGTGCTGTAGCACCGTGTCACCGTGTATGGGCAGCCGTATATTTCATG
GTGAATCTCAGACGTCGCGCTGGGAGTGCTGTACATGAGTTATTATTTCTGGCGCAATAG
CGAATACCAGTACGCTGCAGACTGCAGCACTAGGCCCGTTCGATCAGCCCCGCTGATGAA
CGCGGTAGGCTAGGATGGCGGTACCATCCTGGTTTTTGGACCCTAGGCTCTGAGGCTCTC
AGGCAGGGTGGGATCTTCATGGCCGGTGACGGCGTGAGGAGTAGCGCAGTGCTTTGCGGT
GCGGACCCGCAGGGCGTTTGCAGTATCATTTGGGAATTTGTATTGGGCATTTGGCAGCGG
TTTCGGCAAAAGCAGGCTAGGTGGGTCTGTGATACCAGAGCAAGGCTGACGGCACCAACA
CAGATGCGACCGCGCCTCTTCCCAAACGCAACACCGCCACTTCCCTACCCCGCCACCGCC
CATCCAACTGTACCGCCATCCTCCAACCCGCCGCCGCCACCTATGCCAACTCCGACCTGC
CGCCGCCATCAACCCAACATCGTACCGACTCCAACCTGCGTCGCCCACCAAAGCCCGTAT
CACCTCCAACCCGCCACCGGCCACCCGACTCGACACTGCCACAAACTTGCGATTACCTCG
GCAACAGCGATCGCAATTCGGCTGACCCATTTCTCTGACCCTCCGTCGCAACCCCCGACG
TCAACCATCGCATCGCATCAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000175A_C01 KCC000175A_c01
         (921 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAB62280.1| hydroxyproline-rich glycoprotein DZ-HRGP [Volvox...    44  2e-05
ref|NP_039845.1| Nuclear protein EBNA2 [Human herpesvirus 4] gi|...    51  3e-05
gb|AAA45903.1| nuclear protein EBNA2                                   51  3e-05
ref|NP_730262.2| CG13731-PA [Drosophila melanogaster] gi|2838049...    50  4e-05
prf||1604369A sulfated surface glycoprotein SSG185                     50  5e-05

>emb|CAB62280.1| hydroxyproline-rich glycoprotein DZ-HRGP [Volvox carteri f.
           nagariensis]
          Length = 409

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 27/72 (37%), Positives = 29/72 (39%), Gaps = 1/72 (1%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPP-PPMPTPTCRRHQPNIVPTPTCVAHQ 771
           P   RP   P+ +PP P P    P  PP S PPP PP P P   R  P   P P      
Sbjct: 214 PPSPRP---PSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPS 270

Query: 772 SPYHLQPATGHP 807
            P  L P    P
Sbjct: 271 PPPPLPPPPSPP 282

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 18/40 (45%), Positives = 21/40 (52%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTP 714
           P   +P L P+ +PP P P    P  PP   PPPPP P P
Sbjct: 74  PPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPP 113

 Score = 41.2 bits (95), Expect = 0.025
 Identities = 25/72 (34%), Positives = 30/72 (40%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQS 774
           P+   P   P   PP P P    P  PP  NPPPPP P P      P+  P+P      S
Sbjct: 109 PSPPPPPPPPPPPPPSP-PPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPS 167

Query: 775 PYHLQPATGHPT 810
           P    P +  P+
Sbjct: 168 PPPSPPPSPPPS 179

 Score = 40.4 bits (93), Expect(2) = 2e-05
 Identities = 19/42 (45%), Positives = 24/42 (56%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPT 717
           AP   RP   P+  PPLP P +  P +PP  +PPPP  P P+
Sbjct: 250 APPPPRPPP-PSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPS 290

 Score = 40.0 bits (92), Expect = 0.055
 Identities = 22/64 (34%), Positives = 29/64 (44%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQSPYHLQPATG 801
           PN  PP P P + +P  PP  +PPPP  P P+    +P   P P+    + P    P   
Sbjct: 314 PNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRP---PPPSPSPPKPPPPPSPPPR 370

Query: 802 HPTR 813
            P R
Sbjct: 371 PPRR 374

 Score = 39.7 bits (91), Expect = 0.072
 Identities = 20/53 (37%), Positives = 22/53 (40%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           P    P   P   PP+P P    P  PP  +PPPPP P P      P   P P
Sbjct: 80  PLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPP 132

 Score = 39.3 bits (90), Expect = 0.094
 Identities = 20/44 (45%), Positives = 20/44 (45%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           P   PP P P    P  PP S PPPPP P P      PN  P P
Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPP----PPNPPPPP 143

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 29/93 (31%), Positives = 33/93 (35%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQSPYHLQPATG 801
           P+  PP P P    P  PPS  PPPPP P P      P   P P+     SP    P + 
Sbjct: 109 PSPPPPPPPP----PPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSP 164

Query: 802 HPTRHCHKLAITSATAIAIRLTHFSDPPSQPPT 900
            P                      S PPS PP+
Sbjct: 165 PP----------------------SPPPSPPPS 175

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 21/51 (41%), Positives = 24/51 (46%), Gaps = 2/51 (3%)
 Frame = +1

Query: 607 RPRLFPNATPPLPYPATAHPTVPPSSNPPPP--PMPTPTCRRHQPNIVPTP 753
           RP   P  +PP   P +  P  PPS NPP P  P P+P   R  P   P P
Sbjct: 187 RPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFP 237

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 20/54 (37%), Positives = 22/54 (40%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPT 756
           P    P   P   PP P P    P  PP   PPPPP P P      P+  P P+
Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPS 155

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 23/63 (36%), Positives = 31/63 (48%), Gaps = 1/63 (1%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPT-CRRHQPNIVPTPTCVAHQSPYHLQPAT 798
           P + PP P P +  P+ PPS  P PPP P P+   R  P+  P+P      SP    P +
Sbjct: 153 PPSPPPSP-PPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPS 211

Query: 799 GHP 807
            +P
Sbjct: 212 PNP 214

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 24/74 (32%), Positives = 32/74 (42%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQ 771
           +P    P   P + PP P P +  P  PPS  P PPP P P+     P   P+P   + +
Sbjct: 163 SPPPSPPPSPPPSPPPSP-PPSPPPRPPPSPPPSPPPSPPPS---PPPRPPPSPNPPSPR 218

Query: 772 SPYHLQPATGHPTR 813
            P    P+   P R
Sbjct: 219 PPSPSPPSPRPPPR 232

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 2/61 (3%)
 Frame = +1

Query: 580 ARLTAPTQMRPRLFPNATPP--LPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           A +  P    P   P  TPP  +P P  + P  PP   PPPPP P       QP + P+P
Sbjct: 33  ALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPP-------QPPLPPSP 85

Query: 754 T 756
           +
Sbjct: 86  S 86

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 21/52 (40%), Positives = 23/52 (43%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQSP 777
           P   PPLP P+ + P  PP   PPPPP P P      P   P P      SP
Sbjct: 75  PPPQPPLP-PSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSP 125

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 23/55 (41%), Positives = 25/55 (44%), Gaps = 1/55 (1%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPS-SNPPPPPMPTPTCRRHQPNIVPTPT 756
           PT   P   P   PP P P    P +PPS S PPPPP P P      P   P P+
Sbjct: 58  PTPSGPEHPP--PPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPS 110

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 21/63 (33%), Positives = 27/63 (42%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQ 771
           +P    P   P   PP P P +  P+ PPS  P PPP P P   R      P+P     +
Sbjct: 175 SPPPSPPPSPPPRPPPSP-PPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRR 233

Query: 772 SPY 780
            P+
Sbjct: 234 PPF 236

 Score = 37.0 bits (84), Expect = 0.47
 Identities = 25/73 (34%), Positives = 31/73 (42%), Gaps = 1/73 (1%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPP-PPPMPTPTCRRHQPNIVPTPTCVAHQ 771
           P    P   P   PP P P  + P  PP S PP PPP P P+     P+  P+P      
Sbjct: 134 PPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPS---PPPSPPPSPPPRPPP 190

Query: 772 SPYHLQPATGHPT 810
           SP    P +  P+
Sbjct: 191 SPPPSPPPSPPPS 203

 Score = 37.0 bits (84), Expect = 0.47
 Identities = 16/38 (42%), Positives = 16/38 (42%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQP 735
           P   PP P P    P  P    PPPPP P P   R  P
Sbjct: 339 PRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRPP 376

 Score = 36.6 bits (83), Expect = 0.61
 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 1/55 (1%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPP-PPMPTPTCRRHQPNIVPTP 753
           +P   RP   P   PP P P+   P  PP + PPP PP P+P      P   P P
Sbjct: 223 SPPSPRP---PPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPP 274

 Score = 36.6 bits (83), Expect = 0.61
 Identities = 23/57 (40%), Positives = 26/57 (45%), Gaps = 3/57 (5%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPL--PYPATAHPTVPPSSNPPP-PPMPTPTCRRHQPNIVPTPT 756
           P   RP   P + PP   P PA   P  PP S PPP PP P+P      P   P P+
Sbjct: 229 PPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPS 285

 Score = 36.2 bits (82), Expect = 0.80
 Identities = 24/73 (32%), Positives = 32/73 (42%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQ 771
           +P    P   P + PP P P +  P+ PPS  P PPP P P+     P+  P+P      
Sbjct: 155 SPPPSPPPSPPPSPPPSP-PPSPPPSPPPSPPPRPPPSPPPS---PPPSPPPSPPPRPPP 210

Query: 772 SPYHLQPATGHPT 810
           SP    P    P+
Sbjct: 211 SPNPPSPRPPSPS 223

 Score = 35.8 bits (81), Expect(2) = 0.004
 Identities = 20/48 (41%), Positives = 26/48 (53%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPN 738
           P    P L P  +PP P P    P+ PP S PPP P+P P+ R  +P+
Sbjct: 258 PPSPPPPLPPPPSPPPPLPPP--PSPPPPSPPPPSPLP-PSPRPPKPS 302

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 20/54 (37%), Positives = 27/54 (49%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           +P    P   P + PP P P +  P+ PPS  P PPP P P+     P+  P+P
Sbjct: 151 SPPPSPPPSPPPSPPPSP-PPSPPPSPPPSPPPSPPPRPPPS---PPPSPPPSP 200

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 21/56 (37%), Positives = 23/56 (40%)
 Frame = +1

Query: 586 LTAPTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           L  P    P L P  +PP P P    P +PPS  PP P  P     R  P   P P
Sbjct: 265 LPPPPSPPPPLPPPPSPPPPSPPPPSP-LPPSPRPPKPSPPNNPFPRPPPPNPPPP 319

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 26/70 (37%), Positives = 31/70 (44%), Gaps = 3/70 (4%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPL--PYPATAHPTVPPSSNPPP-PPMPTPTCRRHQPNIVPTPTCVA 765
           P+   PR  P A PP   P P+   P  PP S PPP PP P+P      P   P P    
Sbjct: 239 PSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSP------PPPSPPPPSPL 292

Query: 766 HQSPYHLQPA 795
             SP   +P+
Sbjct: 293 PPSPRPPKPS 302

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 20/53 (37%), Positives = 22/53 (40%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           P +  P   P   PP P P    P  P  S P PPP P+P  R   P   P P
Sbjct: 328 PPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPR--PPRRPPRP 378

 Score = 33.9 bits (76), Expect(2) = 0.37
 Identities = 16/40 (40%), Positives = 16/40 (40%)
 Frame = +1

Query: 619 FPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPN 738
           FP   PP P P    P  P    PPPP  P P      PN
Sbjct: 308 FPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPN 347

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 25/78 (32%), Positives = 28/78 (35%), Gaps = 6/78 (7%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHP--TVPPSSNPPPP----PMPTPTCRRHQPNIVPTP 753
           +P    P   P   PP P P +  P    PPS  PPP     P P+P   R  P   P P
Sbjct: 195 SPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPP 254

Query: 754 TCVAHQSPYHLQPATGHP 807
                  P  L P    P
Sbjct: 255 RPPPPSPPPPLPPPPSPP 272

 Score = 33.5 bits (75), Expect = 5.2
 Identities = 16/39 (41%), Positives = 18/39 (46%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMP 708
           +P+   P   P   PP P P    P  PP   PPPPP P
Sbjct: 84  SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPP 122

 Score = 33.5 bits (75), Expect = 5.2
 Identities = 21/64 (32%), Positives = 28/64 (42%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQSPYHLQPATG 801
           P+  PP P P       PP  NPPPP  P P+    +P   P P+    + P    P + 
Sbjct: 294 PSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRP---PPPSPPPPRPP----PPSP 346

Query: 802 HPTR 813
           +P R
Sbjct: 347 NPPR 350

 Score = 33.1 bits (74), Expect = 6.8
 Identities = 27/105 (25%), Positives = 33/105 (30%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQS 774
           P    P   P + PP P P       PPS  PP P  P+P     +P   P         
Sbjct: 188 PPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPP 247

Query: 775 PYHLQPATGHPTRHCHKLAITSATAIAIRLTHFSDPPSQPPTSTI 909
           P    P    P      L    +    +       PPS PP S +
Sbjct: 248 PPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPL 292

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 19/54 (35%), Positives = 24/54 (44%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           +P    P   P + PP P P+   P+  P S  PP P P P   R  P   P+P
Sbjct: 191 SPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPP---RRPPFPPPSP 241

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 1/57 (1%)
 Frame = +1

Query: 586 LTAPTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPP-PPMPTPTCRRHQPNIVPTP 753
           L AP +  P         +  PA   P  PP   PPP  P PTP+   H P   P P
Sbjct: 17  LGAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPP 73

 Score = 30.4 bits (67), Expect(2) = 2e-05
 Identities = 14/35 (40%), Positives = 15/35 (42%)
 Frame = +3

Query: 720 PPPSTQHRTDSNLRRPPKPVSPPTRHRPPDSTLPQ 824
           PPP        N  RPP P  PP R  PP    P+
Sbjct: 316 PPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPR 350

 Score = 27.3 bits (59), Expect(2) = 0.004
 Identities = 13/35 (37%), Positives = 15/35 (42%)
 Frame = +3

Query: 720 PPPSTQHRTDSNLRRPPKPVSPPTRHRPPDSTLPQ 824
           PPP        N  RPP P   P +  PP S  P+
Sbjct: 336 PPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPR 370

 Score = 22.3 bits (46), Expect(2) = 0.37
 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%)
 Frame = +3

Query: 720 PPPSTQH-RTDSNLRRPPKPVSPPT-RHRPP 806
           PPPS    R       PPKP  PP+   RPP
Sbjct: 342 PPPSPNPPRPPPPSPSPPKPPPPPSPPPRPP 372

>ref|NP_039845.1| Nuclear protein EBNA2 [Human herpesvirus 4]
           gi|119111|sp|P12978|EBN2_EBV EBNA-2 NUCLEAR PROTEIN
           gi|1083964|pir||S42442 nuclear protein EBNA2 - human
           herpesvirus 4 gi|1632787|emb|CAA24877.1| BYRF1, encodes
           EBNA-2 (Dambaugh et al, 1984; Dillner et al, 1984)
           [Human herpesvirus 4] gi|23893590|emb|CAD53395.1| EBNA-2
           nuclear protein [Human herpesvirus 4]
          Length = 487

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 43/115 (37%), Positives = 48/115 (41%), Gaps = 8/115 (6%)
 Frame = +1

Query: 583 RLTAPTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPP----PPMPT-PTCRRHQPNIVP 747
           R TAPT + P   P  TPP P      PT PP+  PP     PP PT PT       + P
Sbjct: 173 RPTAPTILSPLSQPRLTPPQPLMMPPRPT-PPTPLPPATLTVPPRPTRPT------TLPP 225

Query: 748 TPTCVAHQSPYHLQPATGHPTRHCHKLAITSATAIAIRLTHFS---DPPSQPPTS 903
           TP     Q P  LQP    P  H   L +   +     LTH S   DP S  P S
Sbjct: 226 TPLLTVLQRPTELQPTPSPPRMHLPVLHVPDQSMHP--LTHQSTPNDPDSPEPRS 278

 Score = 41.2 bits (95), Expect = 0.025
 Identities = 20/44 (45%), Positives = 21/44 (47%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           P   PP P P    P  PP S PPPPP P P  RR      P+P
Sbjct: 69  PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEPSP 112

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 18/44 (40%), Positives = 21/44 (46%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRR 726
           P  + P   P   PP P P    P  PP  +PPPPP P P  +R
Sbjct: 59  PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQR 102

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 18/40 (45%), Positives = 18/40 (45%)
 Frame = +1

Query: 634 PPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           PPLP P    P  PP   PPPPP P P      P   P P
Sbjct: 60  PPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99

>gb|AAA45903.1| nuclear protein EBNA2
          Length = 490

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 43/115 (37%), Positives = 48/115 (41%), Gaps = 8/115 (6%)
 Frame = +1

Query: 583 RLTAPTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPP----PPMPT-PTCRRHQPNIVP 747
           R TAPT + P   P  TPP P      PT PP+  PP     PP PT PT       + P
Sbjct: 176 RPTAPTILSPLSQPRLTPPQPLMMPPRPT-PPTPLPPATLTVPPRPTRPT------TLPP 228

Query: 748 TPTCVAHQSPYHLQPATGHPTRHCHKLAITSATAIAIRLTHFS---DPPSQPPTS 903
           TP     Q P  LQP    P  H   L +   +     LTH S   DP S  P S
Sbjct: 229 TPLLTVLQRPTELQPTPSPPRMHLPVLHVPDQSMHP--LTHQSTPNDPDSPEPRS 281

 Score = 41.2 bits (95), Expect = 0.025
 Identities = 20/44 (45%), Positives = 21/44 (47%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           P   PP P P    P  PP S PPPPP P P  RR      P+P
Sbjct: 72  PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEPSP 115

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 18/40 (45%), Positives = 18/40 (45%)
 Frame = +1

Query: 634 PPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           PPLP P    P  PP   PPPPP P P      P   P P
Sbjct: 60  PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 99

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 16/35 (45%), Positives = 18/35 (50%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRR 726
           P   PP P P    P  PP  +PPPPP P P  +R
Sbjct: 71  PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQR 105

 Score = 37.0 bits (84), Expect = 0.47
 Identities = 18/44 (40%), Positives = 18/44 (40%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           P   PP P P    P  PP   PPPPP P P      P   P P
Sbjct: 60  PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 103

 Score = 37.0 bits (84), Expect = 0.47
 Identities = 16/35 (45%), Positives = 17/35 (47%)
 Frame = +1

Query: 610 PRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTP 714
           P   P   PP P P    P  PP   PPPPP P+P
Sbjct: 59  PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSP 93

 Score = 36.6 bits (83), Expect = 0.61
 Identities = 18/44 (40%), Positives = 18/44 (40%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           P   PP P P    P  PP   PPPPP P P      P   P P
Sbjct: 59  PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 102

>ref|NP_730262.2| CG13731-PA [Drosophila melanogaster] gi|28380492|gb|AAF49349.4|
           CG13731-PA [Drosophila melanogaster]
          Length = 926

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 38/110 (34%), Positives = 47/110 (42%), Gaps = 9/110 (8%)
 Frame = +1

Query: 598 TQMRPRLFPNATPPLPYPA-TAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQS 774
           T  RP   P   PP P  A T  PT  P +N P PP+   T  R  P   P PT    + 
Sbjct: 353 TTRRPTPPPTRPPPPPTRASTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTPPPTKPPTRP 412

Query: 775 PY-HLQPATGH-------PTRHCHKLAITSATAIAIRLTHFSDPPSQPPT 900
           P  +L P T         PTR   K   T    + +R T  + PP++PPT
Sbjct: 413 PTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPT 462

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 38/117 (32%), Positives = 47/117 (39%), Gaps = 8/117 (6%)
 Frame = +1

Query: 574 TRARLTAPTQMRPRLF---PNATPPLPYPATAHPTVPPSSNPPPP-----PMPTPTCRRH 729
           TR     PT   P +      ATPP   P T  PT PP+  PPPP     P PT     +
Sbjct: 535 TRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPPPPTRASTPAPTYLPPTN 594

Query: 730 QPNIVPTPTCVAHQSPYHLQPATGHPTRHCHKLAITSATAIAIRLTHFSDPPSQPPT 900
           +P    T       +P    P T  PTR       T     ++R T    PP++PPT
Sbjct: 595 KPLPPVTVRTTVRTTPRPTLPPTKPPTRP----PTTYLPPPSVRTTRPPPPPTRPPT 647

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 36/115 (31%), Positives = 44/115 (37%), Gaps = 6/115 (5%)
 Frame = +1

Query: 574 TRARLTAPTQMRPRLF-PNATPPLPYPATAHPTVPPSSNPPPP-----PMPTPTCRRHQP 735
           TR     PT   P  + P    P P   T  PT PP+  PPPP     P PT     ++P
Sbjct: 326 TRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPPTRPPPPPTRASTPAPTYLPPTNKP 385

Query: 736 NIVPTPTCVAHQSPYHLQPATGHPTRHCHKLAITSATAIAIRLTHFSDPPSQPPT 900
               T       +P    P T  PTR       T      +R T    PP++PPT
Sbjct: 386 LPPVTVRTTVRTTPRPTPPPTKPPTRP----PTTYLPPPTVRTTRPPPPPTRPPT 436

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 40/134 (29%), Positives = 51/134 (37%), Gaps = 25/134 (18%)
 Frame = +1

Query: 574  TRARLTAPTQMRPRLF---PNATPPLPYPATAHPTVPPS--------------SNPPPPP 702
            TR     PT   P +      ATPP   P T  PT PP+              +N P PP
Sbjct: 643  TRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNKPLPP 702

Query: 703  MPTPTCRRHQPNIVPTPTCVAHQSP-YHLQPATGH-------PTRHCHKLAITSATAIAI 858
            +   T  R  P     PT    + P  +L P T         PTR   K   T    + +
Sbjct: 703  VTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTV 762

Query: 859  RLTHFSDPPSQPPT 900
            R T  + PP++PPT
Sbjct: 763  RTTRATPPPTRPPT 776

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 40/134 (29%), Positives = 51/134 (37%), Gaps = 25/134 (18%)
 Frame = +1

Query: 574 TRARLTAPTQMRPRLF---PNATPPLPYPATAHPTVPPS--------------SNPPPPP 702
           TR     PT   P +      ATPP   P T  PT PP+              +N P PP
Sbjct: 432 TRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNKPLPP 491

Query: 703 MPTPTCRRHQPNIVPTPTCVAHQSP-YHLQPATGH-------PTRHCHKLAITSATAIAI 858
           +   T  R  P     PT    + P  +L P T         PTR   K   T    + +
Sbjct: 492 VTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTV 551

Query: 859 RLTHFSDPPSQPPT 900
           R T  + PP++PPT
Sbjct: 552 RTTRATPPPTRPPT 565

 Score = 39.7 bits (91), Expect = 0.072
 Identities = 32/109 (29%), Positives = 39/109 (35%)
 Frame = +1

Query: 574  TRARLTAPTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
            TR     PT   P +    T   P P T  PT PP+  P    + TP      P   P P
Sbjct: 746  TRPPTKPPTTYLPPVTVRTTRATP-PPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNKPLP 804

Query: 754  TCVAHQSPYHLQPATGHPTRHCHKLAITSATAIAIRLTHFSDPPSQPPT 900
                  +       T  PTR   K   T      +R T    PP++PPT
Sbjct: 805  PVTVRTTVRTTPRPTLPPTRPPTKPPTTYLPPPTVRTTRPPPPPTRPPT 853

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 36/119 (30%), Positives = 43/119 (35%), Gaps = 10/119 (8%)
 Frame = +1

Query: 574 TRARLTAP--TQMRP--RLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNI 741
           TR   T P  T + P  +  P  T  LP P  +  T PP+  P  PP   P      P  
Sbjct: 244 TRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRPPTTRPPATYLPPTN 303

Query: 742 VPTPTCVAHQSPYHLQPATGHPTRHCHKLAITSATAIAIRLTHFSDP------PSQPPT 900
            P P       P    P T  PTR   K   T   A  +  T+   P      P+ PPT
Sbjct: 304 KPLPPVTTRLPPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPPT 362

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 31/112 (27%), Positives = 37/112 (32%), Gaps = 2/112 (1%)
 Frame = +1

Query: 574 TRARLTAPTQMRP--RLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVP 747
           TR     PT + P  +  P  T  LP P     T PP+  P  PP   P      P   P
Sbjct: 203 TRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKP 262

Query: 748 TPTCVAHQSPYHLQPATGHPTRHCHKLAITSATAIAIRLTHFSDPPSQPPTS 903
            P       P    P T  PTR                      PP++PPT+
Sbjct: 263 LPPVTTRLPPPPPSPRTPPPTR----------------------PPTRPPTT 292

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 28/91 (30%), Positives = 32/91 (34%)
 Frame = +1

Query: 631 TPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQSPYHLQPATGHPT 810
           T P   P T  PT PP+  P  PP P PT     P   P P       P    P T  PT
Sbjct: 183 TQPPTRPPTRPPTRPPTRPPTRPPTPPPTYL--PPTNKPLPPVTTRLPPPPPPPRTPPPT 240

Query: 811 RHCHKLAITSATAIAIRLTHFSDPPSQPPTS 903
           R                      PP++PPT+
Sbjct: 241 R----------------------PPTRPPTT 249

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 27/88 (30%), Positives = 32/88 (35%)
 Frame = +2

Query: 644 PTPPPPIQLYRHPPTRRRHLCQLRPAAAINPTSYRLQPASPTKARITSNPPPATRLDTAT 823
           P  PPP +    PPT R     L P     P     +P  P     T  PPP TR  T  
Sbjct: 320 PRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPP----TRPPPPPTRASTPA 375

Query: 824 NLRLPRQQRSQFG*PISLTLRRNPRRQP 907
              LP   +      +  T+R  PR  P
Sbjct: 376 PTYLPPTNKPLPPVTVRTTVRTTPRPTP 403

 Score = 36.6 bits (83), Expect = 0.61
 Identities = 29/101 (28%), Positives = 39/101 (37%), Gaps = 1/101 (0%)
 Frame = +1

Query: 598 TQMRPRLFPNATPPLPYPATAHPTV-PPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQS 774
           T++ P   P  TPP   P T  PT  PP++  PP   P P      P   P+P     ++
Sbjct: 225 TRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSP-----RT 279

Query: 775 PYHLQPATGHPTRHCHKLAITSATAIAIRLTHFSDPPSQPP 897
           P   +P T  PT       +         +T    PP  PP
Sbjct: 280 PPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPP 320

 Score = 36.6 bits (83), Expect = 0.61
 Identities = 29/98 (29%), Positives = 36/98 (36%), Gaps = 19/98 (19%)
 Frame = +1

Query: 574 TRARLTAPTQMRP--------------RLFPNATPPLPYPATAHPTV---PPS--SNPPP 696
           TRA   APT + P              R  P  TPP   P T  PT    PP+  +  PP
Sbjct: 369 TRASTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTPPPTKPPTRPPTTYLPPPTVRTTRPP 428

Query: 697 PPMPTPTCRRHQPNIVPTPTCVAHQSPYHLQPATGHPT 810
           PP   P  +     + P        +P   +P T  PT
Sbjct: 429 PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPT 466

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 35/116 (30%), Positives = 42/116 (36%), Gaps = 14/116 (12%)
 Frame = +1

Query: 595 PTQMRPRLFPNAT--PPLPYPATAHPTVPPSSNPPPPPMPTPTCRR---HQPNIVP---- 747
           P   RP   P  T  PP+    T   T PP+  P  PP   PT RR     P  +P    
Sbjct: 429 PPPTRPPTKPPTTYLPPVTV-RTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNK 487

Query: 748 -----TPTCVAHQSPYHLQPATGHPTRHCHKLAITSATAIAIRLTHFSDPPSQPPT 900
                T       +P    P T  PTR       T      +R T    PP++PPT
Sbjct: 488 PLPPVTVRTTVRTTPRPTLPPTKPPTRP----PTTYLPPPTVRTTRPPPPPTRPPT 539

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/76 (30%), Positives = 28/76 (36%)
 Frame = +1

Query: 583 RLTAPTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCV 762
           R T  T  RP L P   P  P P T  P     +  PPPP   P  +     + P     
Sbjct: 706 RTTVRTTPRPTLPPTKPPTRP-PTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRT 764

Query: 763 AHQSPYHLQPATGHPT 810
              +P   +P T  PT
Sbjct: 765 TRATPPPTRPPTRPPT 780

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/76 (30%), Positives = 28/76 (36%)
 Frame = +1

Query: 583 RLTAPTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCV 762
           R T  T  RP L P   P  P P T  P     +  PPPP   P  +     + P     
Sbjct: 603 RTTVRTTPRPTLPPTKPPTRP-PTTYLPPPSVRTTRPPPPPTRPPTKPPTTYLPPVTVRT 661

Query: 763 AHQSPYHLQPATGHPT 810
              +P   +P T  PT
Sbjct: 662 TRATPPPTRPPTRPPT 677

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/76 (30%), Positives = 28/76 (36%)
 Frame = +1

Query: 583 RLTAPTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCV 762
           R T  T  RP L P   P  P P T  P     +  PPPP   P  +     + P     
Sbjct: 495 RTTVRTTPRPTLPPTKPPTRP-PTTYLPPPTVRTTRPPPPPTRPPTKPPTTYLPPVTVRT 553

Query: 763 AHQSPYHLQPATGHPT 810
              +P   +P T  PT
Sbjct: 554 TRATPPPTRPPTRPPT 569

 Score = 33.1 bits (74), Expect = 6.8
 Identities = 32/99 (32%), Positives = 40/99 (40%), Gaps = 18/99 (18%)
 Frame = +1

Query: 574  TRARLTAPTQMRPRLFPNATPPLPYPATAHPTVPPSS-----------NPPPPP------ 702
            TR     PT   P      T P P P T  PT PP++            PPPPP      
Sbjct: 823  TRPPTKPPTTYLPPPTVRTTRPPP-PPTRPPTKPPTTYLPPVTVVRTTRPPPPPTRRTTV 881

Query: 703  -MPTPTCRRHQPNIVPTPTCVAHQSPYHLQPATGHPTRH 816
             +P PT R      VP PT    ++  ++ PA   PT+H
Sbjct: 882  YVPPPTVR--TTVYVPPPT---QRTTVYVPPA---PTKH 912

>prf||1604369A sulfated surface glycoprotein SSG185
          Length = 453

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 29/86 (33%), Positives = 42/86 (48%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQ 771
           +P+   P   P   PP P P+   P  PP   PPPPP P+P+  R  P+  P+P      
Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPS--PSPPVPPPP 314

Query: 772 SPYHLQPATGHPTRHCHKLAITSATA 849
           SP  +  + G   R C K+++ +A A
Sbjct: 315 SPSAVTISGGAGERVCLKISVDNAAA 340

 Score = 40.0 bits (92), Expect = 0.055
 Identities = 20/52 (38%), Positives = 23/52 (43%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQSP 777
           P+  PP P P +  P  PP   PPPPP P P+     P   P P      SP
Sbjct: 246 PSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 25/71 (35%), Positives = 28/71 (39%)
 Frame = +1

Query: 595 PTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTPTCVAHQS 774
           P   RP   P+  PP P P    P  PP   PPPPP P+P      P   P P      S
Sbjct: 245 PPSPRP---PSPPPPSPSPPPPPPPPPP---PPPPPPPSPPPPPPPPPPPPPPPPPPSPS 298

Query: 775 PYHLQPATGHP 807
           P    P+   P
Sbjct: 299 PPRKPPSPSPP 309

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = +1

Query: 592 APTQMRPRLFPNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           +P    P+   ++ PP P P+   P+ PP S  PPPP P P      P   P P
Sbjct: 227 SPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPP 280

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 17/44 (38%), Positives = 19/44 (42%)
 Frame = +1

Query: 622 PNATPPLPYPATAHPTVPPSSNPPPPPMPTPTCRRHQPNIVPTP 753
           P + PP P P +  P  P    PPPPP P P      P   P P
Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284



EST assemble image


clone accession position
1 CL75f09_r AV397048 1 489
2 HC042h06_r AV635177 173 647
3 MXL081a04_r BP097766 183 625
4 CL08f08_r AV393535 210 722
5 MXL012g11_r BP093735 247 515
6 MXL007b11_r BP093347 247 711
7 MX037c01_r BP087553 502 922




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research