KCC000174A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000174A_C01 KCC000174A_c01
GAAGCTGCTTCTGGCCAGCCGGACCCTGGCCTGTGCCTTCGGGCATCAGCATCGAGGTCA
AGGGCCGGGCGGTCCGCGTTAAGGGCCCGCGCGGCACCCTGACCCGCGACTTCAAGCACC
TGGCGGTCGATATGTTCCTCACGGAGGAGGATGGACAGAAGGTGCTGAAGGTGGACTGCC
ACTTCGGCAAGAAGAAGCGTCTGGCTTCCATCCGCACTGTGTGCTCGCACGTCAAGAACA
TGTTCACGGGCGTGACCAAGGGCTTCGAGTACAAGATGCGCCTGGTGTATGCCCACTTCC
CCATCAACATCAACATCGAGAACCAGGGCAAGAAGGTGGAGATCCGCAACTTCCTGGGCG
AGAAGCGCGTGCGCGTGGTGAACATGCTGGACGGCGTGAAGATTGCCCGCTCGGATGGTG
TCAAGGATGAGCTGGTGCTGCAGGGCAACGACCTGGAGAACGTGTCCCGCTCCGCTGCCC
TCATCAACCAGTCGTGCCACGTGCGCGTTCTGGACATCCGCAAGTTCCTGGACGGCATCT
ACGTGTCCGAGAAGGGCCTGCTGGTGAAGGACTAAGCGTGTAGCAAGAAGTCGCGTGTAA
CACCTGCAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000174A_C01 KCC000174A_c01
         (609 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P30707|RL9_PEA 60S ribosomal protein L9 (Gibberellin-regulate...   232  4e-60
emb|CAA65987.2| ribosomal protein L9 [Pisum sativum]                  227  1e-58
ref|NP_192783.1| 60S ribosomal protein L9 (RPL90D) [Arabidopsis ...   226  2e-58
gb|AAP92747.1| ribosomal L9-like protein [Oryza sativa (japonica...   225  3e-58
ref|NP_564417.1| 60S ribosomal protein L9 (RPL90B) [Arabidopsis ...   225  4e-58

>sp|P30707|RL9_PEA 60S ribosomal protein L9 (Gibberellin-regulated protein GA)
           gi|100065|pir||S19978 ribosomal protein L9, cytosolic -
           garden pea gi|20727|emb|CAA46273.1| GA [Pisum sativum]
          Length = 193

 Score =  232 bits (591), Expect = 4e-60
 Identities = 113/179 (63%), Positives = 140/179 (78%), Gaps = 1/179 (0%)
 Frame = +3

Query: 33  VPSGISIEVKGRAVRVKGPRGTLTRDFKHLAVDM-FLTEEDGQKVLKVDCHFGKKKRLAS 209
           +P G++I+V  + + V+GPRG L RDFKHL +D   +T+E+G+K LK+D  FG +K  A+
Sbjct: 12  IPDGVTIKVNAKVIEVEGPRGKLVRDFKHLNLDFDLITDENGKKKLKIDAWFGSRKTSAA 71

Query: 210 IRTVCSHVKNMFTGVTKGFEYKMRLVYAHFPININIENQGKKVEIRNFLGEKRVRVVNML 389
           IRT  SHV+N+ TGVTKGF YKMR VYA FPIN +I N  K +EIRNFLGEK+VR V++L
Sbjct: 72  IRTALSHVENLITGVTKGFRYKMRFVYADFPINASITNDNKSIEIRNFLGEKKVRKVDLL 131

Query: 390 DGVKIARSDGVKDELVLQGNDLENVSRSAALINQSCHVRVLDIRKFLDGIYVSEKGLLV 566
           DGV I RS+ VKDE+VL GND+E VSRS ALINQ CHV+  DIRKFLDGIYVSEKG +V
Sbjct: 132 DGVSIIRSEKVKDEVVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKGAVV 190

>emb|CAA65987.2| ribosomal protein L9 [Pisum sativum]
          Length = 195

 Score =  227 bits (578), Expect = 1e-58
 Identities = 113/181 (62%), Positives = 140/181 (76%), Gaps = 3/181 (1%)
 Frame = +3

Query: 33  VPSGISIEVKGRAVRVKGPRGTLTRDFKHLAVDM-FLTEEDGQKVLKVDCHFGKKKRLAS 209
           +P G++I+V  + + V+GPRG L RDFKHL +D   +T+E+G+K LK+D  FG +K  A+
Sbjct: 12  IPDGVTIKVNAKVIEVEGPRGKLVRDFKHLNLDFDLITDENGKKKLKIDAWFGSRKTSAA 71

Query: 210 IRTVCSHVKNMFTGVTKGFEYKMRLVYAHFPININIENQGKKVEIRNFLGEKRVRVVNML 389
           IRT  SHV+N+ TGVTKGF YKMR VYA FPIN +I N  K +EIRNFLGEK+VR V++L
Sbjct: 72  IRTALSHVENLITGVTKGFRYKMRFVYADFPINASITNDNKSIEIRNFLGEKKVRKVDLL 131

Query: 390 DGVKIARSDGVKDELVLQGNDLENVSRSAALIN--QSCHVRVLDIRKFLDGIYVSEKGLL 563
           DGV I RS+ VKDE+VL GND+E VSRS ALIN  Q CHV+  DIRKFLDGIYVSEKG +
Sbjct: 132 DGVSIIRSEKVKDEVVLDGNDIELVSRSCALINQEQKCHVKKKDIRKFLDGIYVSEKGAV 191

Query: 564 V 566
           V
Sbjct: 192 V 192

>ref|NP_192783.1| 60S ribosomal protein L9 (RPL90D) [Arabidopsis thaliana]
           gi|7440701|pir||T04180 ribosomal protein L9.F7L13.30,
           cytosolic - Arabidopsis thaliana
           gi|4539405|emb|CAB40038.1| putative ribosomal protein
           L9, cytosolic [Arabidopsis thaliana]
           gi|7267742|emb|CAB78168.1| putative ribosomal protein
           L9, cytosolic [Arabidopsis thaliana]
           gi|17529050|gb|AAL38735.1| putative ribosomal protein L9
           [Arabidopsis thaliana] gi|21436441|gb|AAM51421.1|
           putative ribosomal protein L9 [Arabidopsis thaliana]
           gi|21554221|gb|AAM63297.1| putative ribosomal protein
           L9, cytosolic [Arabidopsis thaliana]
          Length = 194

 Score =  226 bits (577), Expect = 2e-58
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = +3

Query: 33  VPSGISIEVKGRAVRVKGPRGTLTRDFKHLAVDMFLTEED--GQKVLKVDCHFGKKKRLA 206
           +P G++I+V  + + V+GPRG LTRDFKHL +D  L ++   G++ LK+D  FG +K  A
Sbjct: 12  IPDGVAIKVNAKVIEVEGPRGKLTRDFKHLNLDFQLIKDQVTGKRQLKIDSWFGSRKTSA 71

Query: 207 SIRTVCSHVKNMFTGVTKGFEYKMRLVYAHFPININIENQGKKVEIRNFLGEKRVRVVNM 386
           SIRT  SHV N+  GVT+GF Y+MR VYAHFPIN +I+   K +EIRNFLGEK+VR V M
Sbjct: 72  SIRTALSHVDNLIAGVTQGFLYRMRFVYAHFPINASIDGNNKSIEIRNFLGEKKVRKVEM 131

Query: 387 LDGVKIARSDGVKDELVLQGNDLENVSRSAALINQSCHVRVLDIRKFLDGIYVSEKG 557
           LDGVKI RS+ VKDE++L+GND+E VSRS ALINQ CHV+  DIRKFLDGIYVSEKG
Sbjct: 132 LDGVKIVRSEKVKDEIILEGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKG 188

>gb|AAP92747.1| ribosomal L9-like protein [Oryza sativa (japonica cultivar-group)]
          Length = 190

 Score =  225 bits (574), Expect = 3e-58
 Identities = 111/180 (61%), Positives = 140/180 (77%)
 Frame = +3

Query: 33  VPSGISIEVKGRAVRVKGPRGTLTRDFKHLAVDMFLTEEDGQKVLKVDCHFGKKKRLASI 212
           +P G++++V  + V V+GPRG LTR+FKHL +D  L E  G + L+VD  FG ++ +A+I
Sbjct: 12  IPEGVTVQVAAKVVTVEGPRGKLTRNFKHLNLDFQLLE--GGRKLQVDAWFGTRRTMAAI 69

Query: 213 RTVCSHVKNMFTGVTKGFEYKMRLVYAHFPININIENQGKKVEIRNFLGEKRVRVVNMLD 392
           RT  SHV+N+ TGVTKG+ YKMR VYAHFPIN +I N    +EIRNFLGEK+VR V+ML+
Sbjct: 70  RTAISHVQNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRNFLGEKKVRKVDMLE 129

Query: 393 GVKIARSDGVKDELVLQGNDLENVSRSAALINQSCHVRVLDIRKFLDGIYVSEKGLLVKD 572
           GV I RS+ VKDELVL GND+E VSRSAALINQ CHV+  DIRKFLDGIYVS+KG + +D
Sbjct: 130 GVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSDKGTITED 189

>ref|NP_564417.1| 60S ribosomal protein L9 (RPL90B) [Arabidopsis thaliana]
           gi|18398761|ref|NP_564418.1| 60S ribosomal protein L9
           (RPL90A/C) [Arabidopsis thaliana]
           gi|22096367|sp|P49209|RL9_ARATH 60S ribosomal protein L9
           gi|25295039|pir||F86455 probable 60S ribosomal protein
           L9 [imported] - Arabidopsis thaliana
           gi|9665161|gb|AAF97345.1|AC021045_2 Putative 60S
           ribosomal protein L9 [Arabidopsis thaliana]
           gi|9665164|gb|AAF97348.1|AC021045_5 Putative 60S
           ribosomal protein L9 [Arabidopsis thaliana]
           gi|11692872|gb|AAG40039.1|AF324688_1 At1g33120
           [Arabidopsis thaliana]
           gi|11908052|gb|AAG41455.1|AF326873_1 putative ribosomal
           protein L9 [Arabidopsis thaliana]
           gi|12642868|gb|AAK00376.1|AF339694_1 putative ribosomal
           protein L9 [Arabidopsis thaliana]
           gi|14030657|gb|AAK53003.1|AF375419_1 At1g33140/T9L6_10
           [Arabidopsis thaliana] gi|14517516|gb|AAK62648.1|
           At1g33140/T9L6_10 [Arabidopsis thaliana]
           gi|15809778|gb|AAL06817.1| At1g33140/T9L6_10
           [Arabidopsis thaliana] gi|16604306|gb|AAL24159.1|
           At1g33140/T9L6_10 [Arabidopsis thaliana]
           gi|18253023|gb|AAL62438.1| ribosomal protein L9,
           putative [Arabidopsis thaliana]
           gi|22136464|gb|AAM91310.1| ribosomal protein L9,
           putative [Arabidopsis thaliana]
          Length = 194

 Score =  225 bits (573), Expect = 4e-58
 Identities = 112/182 (61%), Positives = 137/182 (74%), Gaps = 2/182 (1%)
 Frame = +3

Query: 33  VPSGISIEVKGRAVRVKGPRGTLTRDFKHLAVDMFLTE--EDGQKVLKVDCHFGKKKRLA 206
           +P  ++I+V  + + V+GPRG L RDFKHL +D  L +  E G+K LK+D  FG +K  A
Sbjct: 12  IPDSVTIKVHAKVIEVEGPRGKLVRDFKHLNLDFQLIKDPETGKKKLKIDSWFGTRKTSA 71

Query: 207 SIRTVCSHVKNMFTGVTKGFEYKMRLVYAHFPININIENQGKKVEIRNFLGEKRVRVVNM 386
           SIRT  SHV N+ +GVT+GF YKMR VYAHFPIN +I   GK +EIRNFLGEK+VR V M
Sbjct: 72  SIRTALSHVDNLISGVTRGFRYKMRFVYAHFPINASIGGDGKSIEIRNFLGEKKVRKVEM 131

Query: 387 LDGVKIARSDGVKDELVLQGNDLENVSRSAALINQSCHVRVLDIRKFLDGIYVSEKGLLV 566
           LDGV I RS+ VKDE+VL GND+E VSRS ALINQ CHV+  DIRKFLDGIYVSEK  +V
Sbjct: 132 LDGVTIVRSEKVKDEIVLDGNDIELVSRSCALINQKCHVKKKDIRKFLDGIYVSEKSKIV 191

Query: 567 KD 572
           ++
Sbjct: 192 EE 193



EST assemble image


clone accession position
1 CL55g12_r AV396045 1 606
2 CL58f06_r AV396224 2 617
3 CL19d02_r AV394153 5 617
4 MXL066h03_r BP096906 8 520
5 CL33e03_r AV394981 8 650
6 LC100f10_r AV625983 68 541
7 HCL027b03_r AV641061 76 557
8 HC066h11_r AV636976 77 532
9 CL48d02_r AV395825 77 614
10 MXL031b02_r BP094852 77 510
11 CL17b02_r AV394142 77 625
12 CM032h01_r AV388506 77 334
13 CL56c04_r AV396085 77 588
14 CL32g05_r AV394836 77 615
15 CM048e03_r AV389069 80 505
16 LC025e01_r AV620683 81 526
17 LC052e10_r AV622656 81 624
18 HC042e06_r AV635148 81 572
19 MX050f07_r BP088065 81 446
20 LC072c05_r AV624051 81 596
21 LC034a03_r AV621292 81 621
22 CL40d04_r AV395361 82 606
23 LC006b03_r AV619284 82 607
24 MX028b09_r BP087209 82 536
25 LC055e05_r AV622847 83 651
26 MX067d11_r BP088729 84 398
27 MX257e03_r BP092667 84 597
28 MX027a09_r BP087164 84 476
29 HC097h08_r AV639325 84 617
30 MX068a01_r BP088753 84 424
31 HC059f04_r AV636446 85 615
32 MX234b09_r BP091128 86 376
33 MX024e11_r BP087077 86 532
34 MXL055a02_r BP096231 87 469
35 MX051f01_r BP088099 87 444
36 MXL097d08_r BP098688 87 473
37 MXL029h07_r BP094800 87 564
38 MX228a12_r BP090721 87 396
39 HCL010d07_r AV640099 88 357
40 HC077e03_r AV637787 88 427
41 MX037b08_r BP087550 88 602
42 MXL015g01_r BP093925 88 414
43 CS001b03_r AV397953 89 645
44 CS001d07_r AV397963 89 639
45 CS001e06_r AV397987 89 630
46 CM076f06_r AV391730 90 714
47 MXL091g02_r BP098334 90 421
48 MX015f01_r BP086732 90 614
49 CS001h11_r AV397998 90 517
50 HCL018c04_r AV640555 90 610
51 MXL060b07_r BP096523 90 480
52 CL15b10_r AV393942 91 528
53 CL15g07_r AV393961 91 595
54 CL08e11_r AV393547 91 654
55 MX020b12_r BP086918 92 463
56 CS001b05_r AV398006 92 643
57 CL43g08_r AV395562 92 614
58 CL74g02_r AV396457 92 654
59 CL80d03_r AV397325 94 512
60 MX207e12_r BP089452 94 591
61 CL76b08_r AV397140 94 548
62 MX229d10_r BP090810 94 388
63 CL09a01_r AV393707 96 631
64 CL51g09_r AV395921 97 616
65 MX028c02_r BP087214 97 533
66 LC055f08_r AV622860 98 611
67 CL68d11_r AV396957 98 653
68 CL61a07_r AV396305 102 646
69 CL35c06_r AV395064 110 625
70 CM066c04_r AV390813 113 716
71 CL61b05_r AV396334 134 710
72 CM003c10_r AV386609 148 670
73 MX101b02_r BP088790 156 542
74 CL64f11_r AV396670 156 700
75 CL23a09_r AV394505 157 699
76 CL09b07_r AV393736 158 635
77 CL78f09_r AV397238 165 708
78 CL42b05_r AV395460 176 570
79 CM044e10_r AV389548 176 715
80 MX103b07_r BP088960 187 708
81 MX102b07_r BP088880 189 708
82 CL47e01_r AV395683 193 717
83 MX102a04_r BP088865 213 708
84 MX101b03_r BP088791 213 708
85 MX102g03_r BP088923 213 789
86 MX101d04_r BP088812 213 711
87 MX102b05_r BP088878 213 708
88 CM084e12_r AV392643 215 574
89 LC078c10_r AV624481 241 694
90 CL71a10_r AV396871 243 715
91 LC082c04_r AV624759 252 763
92 CS001h04_r AV397946 269 771
93 LC078g12_r AV624518 283 756
94 HCL030d12_r AV641248 289 715
95 MX101a09_r BP088787 291 708
96 MX101c09_r BP088807 292 708
97 MX101d12_r BP088820 292 708
98 MX102d01_r BP088893 295 708
99 MX102h01_r BP088932 304 708
100 MX102f11_r BP088920 310 708
101 MX101h07_r BP088857 311 815
102 LC005e02_r AV619232 337 771
103 HCL013c06_r AV640258 360 648
104 MX103e09_r BP088992 361 708
105 MX104c01_r BP089048 368 708
106 HCL091g12_r AV644658 383 717
107 HCL096g05_r AV644997 537 717
108 MX102g07_r BP088927 601 708




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research