KCC000173A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000173A_C01 KCC000173A_c01
GCACGGTTTACCAGTTTAGTTTTCTGAATTCGCCCTGGAGTCATTCCGCCCGCTCCTGCG
ACTTCAGCGAGCGACTCGCCCCTTGCTCTTTCTCTTCCTGGTTGCGTGTCTAGCCTGACA
CTGCTTCCCCTCGCAACCATGGCTTCCTACAAGCCCAAGAGCGTGAAGGATGTGCCGGCG
GAGGACTTCATTAAGGCCTACGCTGCGCACCTGAAGGCCAACGATAAGATCCAGCTGCCC
AGCTGGGTGGATGTGGTGAAGACCGGCAAGTTCAAGGAGCTGGCCCCCTACGACCCCGAC
TGGTACTACGTGCGCGCTGCCTCGGTGGCCCGCAAGCTGTACATCCGCCAGGGCATGGGT
GTCGGTCTGTTCCGCACTCAGTACGGTGGCCGCAACAAGCGCCGCGGCTCCAAGCCCGAG
TTCCAGTCCAAGGCTTCTGGCGGCCTGGTTCGCCACATCATGAAGCAGCTGGAGGAGTGC
GGCCTGATGGAGAAGGCCCCCGAGAAGGGTCGCCGCCTGACCGCCAACGGCCAGCGCGAC
ATGGACCAGATTGCCGGCCGCATCACCGTCCAGCTGCAGGCTTTCTTCTAAGCGCGCAAC
AGCGCTTGAGCGGATAAGTCCACCCGGCGGCTGCCGCGAGGCAGTAGCAGCAGCTATGGC
AGCGGCGAACGGAGCGGGAGCAGCAGCGTGAGCGGCAGCAGTGGCAGGCACTGCAAACGG
GTGGATGTGGCGGCGGCGAACGACCGGGGGGCTCTCCGGGAGGAGGCTGGCCGTGAAATG
GAACGGCTTGTATTCGGCGCACGTGTGATTGTGTGGGCAGCGCACCATGCGCCCCGTCCT
CGGTGCGACAGCTCATGCTTACGGGCAGGGCTGCAAACGTGCCTCCTCCGTTGTCGATGG
AGGAGAGGACGACCTGCCAGGGTGCTGGAGGGCTGTGGTCCATGCGTGCGTGCTCTTGGC
GTGTGGGCAATGCAATGTGTGGCCATGGCAGCGCGGTGATGCTGGCCCGCGTCGGAAGAG
ACGTTCTATGAGGTTATGTGTAACACGCACACGCAAAAAAAAAAAAAAAAAAACTCGATA
CTAGTTCGCTCTCTC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000173A_C01 KCC000173A_c01
         (1095 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_186857.1| 40S ribosomal protein S19 (RPS19A) [Arabidopsis...   187  4e-46
ref|NP_197056.1| 40S ribosomal protein S19 (RPS19B) [Arabidopsis...   183  4e-45
ref|NP_200925.1| 40S ribosomal protein S19 (RPS19C) [Arabidopsis...   179  8e-44
sp|P40978|RS19_ORYSA 40S RIBOSOMAL PROTEIN S19 gi|30089738|gb|AA...   174  2e-42
gb|AAN39006.1| putative 40S ribosomal protein S19 [Griffithsia j...   155  2e-36

>ref|NP_186857.1| 40S ribosomal protein S19 (RPS19A) [Arabidopsis thaliana]
           gi|27923843|sp|Q9SGA6|R191_ARATH 40S ribosomal protein
           S19-1 gi|6513924|gb|AAF14828.1|AC011664_10 putative 40S
           ribosomal protein S19 [Arabidopsis thaliana]
           gi|13878029|gb|AAK44092.1|AF370277_1 putative 40S
           ribosomal protein S19 [Arabidopsis thaliana]
           gi|17104595|gb|AAL34186.1| putative 40S ribosomal
           protein S19 [Arabidopsis thaliana]
           gi|21593712|gb|AAM65679.1| putative 40S ribosomal
           protein S19 [Arabidopsis thaliana]
          Length = 143

 Score =  187 bits (474), Expect = 4e-46
 Identities = 86/139 (61%), Positives = 113/139 (80%)
 Frame = +1

Query: 157 KSVKDVPAEDFIKAYAAHLKANDKIQLPSWVDVVKTGKFKELAPYDPDWYYVRAASVARK 336
           K+VKDV   DF+KAYA+HLK + KI+LP+W D+VKTGK KELAPYDPDWYY+RAAS+ARK
Sbjct: 5   KTVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARK 64

Query: 337 LYIRQGMGVGLFRTQYGGRNKRRGSKPEFQSKASGGLVRHIMKQLEECGLMEKAPEKGRR 516
           +Y+R G+GVG FR  YGG +KR GS+P    K+SGG+ RHI++QLE   ++E   + GRR
Sbjct: 65  VYLRGGLGVGAFRRIYGG-SKRNGSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRR 123

Query: 517 LTANGQRDMDQIAGRITVQ 573
           +T++GQRD+DQ+AGRI V+
Sbjct: 124 ITSSGQRDLDQVAGRIAVE 142

>ref|NP_197056.1| 40S ribosomal protein S19 (RPS19B) [Arabidopsis thaliana]
           gi|27923841|sp|Q9LF30|R192_ARATH 40S ribosomal protein
           S19-2 gi|11276633|pir||T51530 40S RIBOSOMAL PROTEIN
           S19-like - Arabidopsis thaliana
           gi|9755807|emb|CAC01751.1| 40S RIBOSOMAL PROTEIN
           S19-like [Arabidopsis thaliana]
           gi|21554401|gb|AAM63506.1| 40S ribosomal protein
           S19-like [Arabidopsis thaliana]
           gi|28466827|gb|AAO44022.1| At5g15520 [Arabidopsis
           thaliana]
          Length = 143

 Score =  183 bits (465), Expect = 4e-45
 Identities = 84/139 (60%), Positives = 111/139 (79%)
 Frame = +1

Query: 157 KSVKDVPAEDFIKAYAAHLKANDKIQLPSWVDVVKTGKFKELAPYDPDWYYVRAASVARK 336
           K+VKDV   DF+KAYA+HLK + KI+LP W D+VKTG+ KELAPYDPDWYY+RAAS+ARK
Sbjct: 5   KTVKDVSPHDFVKAYASHLKRSGKIELPLWTDIVKTGRLKELAPYDPDWYYIRAASMARK 64

Query: 337 LYIRQGMGVGLFRTQYGGRNKRRGSKPEFQSKASGGLVRHIMKQLEECGLMEKAPEKGRR 516
           +Y+R G+GVG FR  YGG +KR GS+P    K+SGG+ RHI++QLE   ++E   + GRR
Sbjct: 65  IYLRGGLGVGAFRRIYGG-SKRNGSRPPHFCKSSGGIARHILQQLETMSIVELDTKGGRR 123

Query: 517 LTANGQRDMDQIAGRITVQ 573
           +T++GQRD+DQ+AGRI  +
Sbjct: 124 ITSSGQRDLDQVAGRIAAE 142

>ref|NP_200925.1| 40S ribosomal protein S19 (RPS19C) [Arabidopsis thaliana]
           gi|27923837|sp|Q9FNP8|R193_ARATH 40S ribosomal protein
           S19-3 gi|9759463|dbj|BAB10379.1| 40S ribosomal protein
           S19 [Arabidopsis thaliana] gi|34365671|gb|AAQ65147.1|
           At5g61170 [Arabidopsis thaliana]
          Length = 143

 Score =  179 bits (454), Expect = 8e-44
 Identities = 82/136 (60%), Positives = 110/136 (80%)
 Frame = +1

Query: 157 KSVKDVPAEDFIKAYAAHLKANDKIQLPSWVDVVKTGKFKELAPYDPDWYYVRAASVARK 336
           K+VKDV   +F+KAYAAHLK + KI+LP W D+VKTGK KELAPYDPDWYY+RAAS+ARK
Sbjct: 5   KTVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAASMARK 64

Query: 337 LYIRQGMGVGLFRTQYGGRNKRRGSKPEFQSKASGGLVRHIMKQLEECGLMEKAPEKGRR 516
           +Y+R G+GVG FR  YGG +KR GS+P    K+SGG+ RHI++QL+   +++   + GR+
Sbjct: 65  VYLRGGLGVGAFRRIYGG-SKRNGSRPPHFCKSSGGVARHILQQLQTMNIVDLDTKGGRK 123

Query: 517 LTANGQRDMDQIAGRI 564
           +T++GQRD+DQ+AGRI
Sbjct: 124 ITSSGQRDLDQVAGRI 139

>sp|P40978|RS19_ORYSA 40S RIBOSOMAL PROTEIN S19 gi|30089738|gb|AAP20842.1| putative
           ribosomal protein S19 [Oryza sativa (japonica
           cultivar-group)] gi|30089751|gb|AAP20855.1| putative
           ribosomal protein S19 [Oryza sativa (japonica
           cultivar-group)]
          Length = 146

 Score =  174 bits (442), Expect = 2e-42
 Identities = 79/146 (54%), Positives = 114/146 (77%)
 Frame = +1

Query: 139 MASYKPKSVKDVPAEDFIKAYAAHLKANDKIQLPSWVDVVKTGKFKELAPYDPDWYYVRA 318
           MA    ++VKDV   +F+KAY+AHLK + K++LP WVD+VKT +FKEL PYDPDWYY RA
Sbjct: 1   MADSTARTVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRA 60

Query: 319 ASVARKLYIRQGMGVGLFRTQYGGRNKRRGSKPEFQSKASGGLVRHIMKQLEECGLMEKA 498
           AS+ARK+Y+RQG+GVG F+  YGGR +R GS+P    K+SG + R+I++QL++ G+++  
Sbjct: 61  ASIARKIYLRQGIGVGGFQKIYGGR-QRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVD 119

Query: 499 PEKGRRLTANGQRDMDQIAGRITVQL 576
           P+ GR +T+ G+RD+DQ+AGR+ V +
Sbjct: 120 PKGGRLITSQGRRDLDQVAGRVDVTI 145

>gb|AAN39006.1| putative 40S ribosomal protein S19 [Griffithsia japonica]
          Length = 150

 Score =  155 bits (391), Expect = 2e-36
 Identities = 75/134 (55%), Positives = 97/134 (71%)
 Frame = +1

Query: 160 SVKDVPAEDFIKAYAAHLKANDKIQLPSWVDVVKTGKFKELAPYDPDWYYVRAASVARKL 339
           +VKDVPA +F+  YA+HLK    I++P WVD +KT   +ELAPYDPDW Y+R AS+ARKL
Sbjct: 12  TVKDVPAAEFVNTYASHLKRVGMIEIPPWVDTIKTAASRELAPYDPDWLYIRIASIARKL 71

Query: 340 YIRQGMGVGLFRTQYGGRNKRRGSKPEFQSKASGGLVRHIMKQLEECGLMEKAPEKGRRL 519
           YIR G+G G FR  YG R KRRG KP   SK+SGGL+R+ ++QLE+ G+ EK    GRR+
Sbjct: 72  YIRGGIGTGEFRKIYGDR-KRRGMKPCRSSKSSGGLIRYSLQQLEKLGVAEKDERGGRRI 130

Query: 520 TANGQRDMDQIAGR 561
           T+ GQ +MD  A +
Sbjct: 131 TSKGQSEMDTQASQ 144



EST assemble image


clone accession position
1 HC047h03_r AV635559 1 607
2 MX215h09_r BP089914 115 615
3 CL08d12_r AV393539 125 731
4 HCL057c07_r AV642756 134 728
5 CM068f05_r AV391035 196 822
6 MXL012c04_r BP093700 199 660
7 CM086b12_r AV392498 203 755
8 CM079h06_r AV391957 207 700
9 CM039e04_r AV388985 207 568
10 CM027e01_r AV387583 212 763
11 CM043e02_r AV389506 212 473
12 CM010g04_r AV386969 213 661
13 LC077h10_r AV624450 213 640
14 LCL045g05_r AV628695 213 496
15 HC018d07_r AV633238 214 745
16 MXL051h12_r BP096065 214 462
17 MXL082b07_r BP097841 214 662
18 HCL090d02_r AV644547 214 547
19 HC035a04_r AV634564 214 741
20 HCL100f03_r AV645283 214 650
21 LC097g01_r AV625777 215 580
22 LCL019b01_r AV626969 215 727
23 LC018f03_r AV620176 215 738
24 MXL023b05_r BP094444 215 702
25 LC026b08_r AV620735 215 718
26 MXL023c02_r BP094451 216 516
27 HC086g06_r AV638468 216 626
28 HC096b09_r AV639193 216 656
29 CM058g08_r AV390354 216 812
30 LCL076d01_r AV630265 216 535
31 MXL015f05_r BP093921 217 478
32 HC056d02_r AV636195 219 685
33 MXL044c11_r BP095593 219 682
34 HC020a03_r AV633367 219 626
35 HC096c05_r AV639200 219 721
36 MX007a08_r BP086346 219 611
37 MXL089c09_r BP098203 219 590
38 CM032h07_r AV388467 219 710
39 HC026e03_r AV633885 219 782
40 HC015a10_r AV632973 220 583
41 LC011d10_r AV619659 220 767
42 HC059d10_r AV636435 220 685
43 MXL053h02_r BP096162 220 631
44 HC089h04_r AV638717 220 647
45 HC046h02_r AV635480 220 729
46 HC028b01_r AV634012 221 733
47 MX251b08_r BP092214 221 732
48 MXL061f01_r BP096601 221 719
49 CM021g08_r AV387955 222 808
50 CM034a09_r AV388676 222 746
51 HC089a02_r AV638646 222 728
52 CL31e06_r AV395028 222 770
53 CL47g07_r AV395708 225 652
54 HC037e06_r AV634757 229 642
55 CM028b06_r AV387704 230 841
56 CS001a11_r AV397991 232 794
57 CM065a10_r AV391136 237 843
58 CL21e06_r AV394363 239 683
59 HCL047c07_r AV642196 243 493
60 LC045c09_r AV622051 274 797
61 HC023d10_r AV633646 285 729
62 LCL004a10_r AV626195 394 851
63 CL58a05_r AV396194 512 1117
64 CM060a12_r AV390783 659 1266
65 LC087h10_r AV625105 663 1106
66 CL35c04_r AV395088 667 1168
67 CL45d12_r AV397806 682 1168
68 LC046g12_r AV622227 694 1168
69 HC040f03_r AV634997 755 1315
70 CM045b03_r AV389720 755 1165
71 HCL100d01_r AV645261 854 1165




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research